triangle PDBeMotif: 3bx9  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification fluorescent protein    | release date: Fri, Jan 11, 2008
Title monomeric far-red fluorescent protein mkate crystallized at
Authors N.PLETNEVA, S.PLETNEV, V.PLETNEV
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL   search CIT CIT binding statistics CIT
Modified residues:  search NRQ NRQ binding statistics NRQ
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MRGSHHHHHHGSMSELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKT
FINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLY
PADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKL
GHKLN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FAR-RED FLUORESCENT PROTEIN MKATE
member of: CATH:search2.40.155.10
JMol viewer RasMol script viewer  GOL 237A  ..                                                              ..                                *                               **                                                                                                 
JMol viewer RasMol script viewer  CIT 236A  ..                             * *    * *                       ..                                |                               ||                                                                                  *              
JMol viewer RasMol script viewer  CIT 235A  ..                             | |    | |                       ..     * *                        |                               ||                                                                                  |   *          
JMol viewer RasMol script viewer  CIT 234A  ..                  **         | |    | |                       ..     | |                        |                          **   ||                                                                                  |   |          
sec str:  .........eeeeeeeeeee..eeeeeeeeeeee....eeeeeeeeee......hhhhhhhhh........ee.......hhhhh...eeeeeeeee....eeeeeeeeeee..eeeeeeeeeee............eeee..eeeeeeee..eeeeeeeeeeee....eeeeeeeeeeee..hhhhh.....eeeeeeeeeeeee....eeeeeeeeeee........
sequence :  ..SELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYG..SKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKL
seq num:  ..2         12        22        32        42        52          ..66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |           | |  |     |  | |  | | | |   |  |     |  |     ..     ^***      | || ||      | |||||   |    |  |          |  ||  |   ||||              |    |                   | || | |  |              || |  ||| |         | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |           | |  |     |  | |  | | ^**   |  |     |  |     ..               | || ||      | |||||   |    |  |          |  ||  |   ||||              |    |                   ^**^** |  |              || |  ||| |         | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..** |           | |  |     ^*** |  | |       |  |     |  |     ..               | ^***|      ^***|||   |    ^***          |  ||  |   ||||              |    |                      | | |  |              || |  |^***         | |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |           | |  |          |  | |       |  |     |  |     ..               | ||  |        | |||   |                  |  ||  |   ||||              |    |                      | | |  |              |*******^           | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |           ^*****          |  | |       |  |     |  |     ..               | ||  |        | |^*****                  |  ||  |   ||||              ^*****                      | | |  |              || |  |||           | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |             |  |          |  | |       |  |     |  |     ..               | *****        | |||                      |  ||  |   ||||                                          | | |  |              || |  |||           | |    
search RasMol script viewer Motif-ligand binding stats  betabulge .. | |             |  |          |  | |       |  |     |  |     ..               |  |           | |||                      |  ||  |   ||||                                          | | |  |              ** |  |**           | |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. | |             |  |          ******       |  |     |  |     ..               |  |           *****                      |  ||  |   ||||                                          | | |  |                 ******           | |    
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |             ****             | |       |  |     ****     ..               |  |           ****|                      |  ||  |   ||||                                          | | |  |                    | |           | |    
search RasMol script viewer Motif-ligand binding stats  nest .. | |                              ***       |  |              ..               |  |             ***                      |  ||  |   ****                                          | | |  |                    ***           | |    
search RasMol script viewer Motif-ligand binding stats  niche .. ***                                        ****              ..               ****                                      ********    ***                                          *** ****                                  ***    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                              ..                                                                                                                  ***                                              

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : FAR-RED FLUORESCENT PROTEIN MKATE
member of: CATH:search2.40.155.10
JMol viewer RasMol script viewer  GOL 237B  ..                                                              ..                                *                            * ***                                                                                                 
JMol viewer RasMol script viewer  CIT 236B  ..  *                                                           ..                   *            |           * **             | |||                                                                                                 
JMol viewer RasMol script viewer  CIT 235B  ..  |               **                                          ..                   |            |           | ||           **| |||                                                                                                 
sec str:  .........eeeeeeeeeee..eeeeeeeeeeee....eeeeeeeeee......hhhhhhhhh........ee.......hhhhh...eeeeeeeee....eeeeeeeeeee..eeeeeeeeeee............eeee..eeeeeeee..eeeeeeeeeeee....eeeeeeeeeeee..hhhhh.....eeeeeeeeeeeee....eeeeeeeeeee........
sequence :  ..SELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYG..SKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKL
seq num:  ..2         12        22        32        42        52          ..66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |             | |  |     |  |    | | | |   || |     |  |     ..     ^***    | | || |       |  ||||   |    |  |          |  ||  |   ||||              |    |                   | || | |  |               | |  ||| |         | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |             | |  |     |  |    | | ^**   || |     |  |     ..             | | || |       |  ||||   |    |  |          |  ||  |   ||||              |    |                   ^**^** |  |               | |  ||| |         | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**             | |  |     ^***    | |       || |     |  |     ..             | | ^***       ^***|||   |    ^***          |  ||  |   ||||              |    |                      | | |  |               | |  |^***         | |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..               | |  |             | |       || |     |  |     ..             | | ||             |||   |                  |  ||  |   ||||              |    |                      | | |  |               *******^           | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..               ^*****             | |       || |     |  |     ..             | | ||             |^*****                  |  ||  |   ||||              ^*****                      | | |  |                 |  |||           | |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 |  |             | |       ** |     |  |     ..             | | ||             | |                      |  ||  |   ||||                                          | | |  |                 |  |**           | |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                 |  |             | |       |  |     |  |     ..             | | ||             | |                      |  ||  |   ||||                                          | | |  |                 ******           | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 ****             | |       |  |     ****     ..             | | ||             | |                      |  ||  |   ||||                                          | | ****                    | |           | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                                  ***       |  |              ..             | | ||             ***                      |  ||  |   ****                                          | | |  |                    ***           | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                            ****              ..             | ****                                      ********                                                 *** ****                                  ***    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                              ..             *****                                                                                                | |                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                              ..                                                                                                                  ***                                              

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FAR-RED FLUORESCENT PROTEIN MKATE
member of: CATH:search2.40.155.10
JMol viewer RasMol script viewer  GOL 237A  ..                                                              ..                                *                               **                                                                                                 
JMol viewer RasMol script viewer  CIT 236A  ..                             * *    * *                       ..                                |                               ||                                                                                  *              
JMol viewer RasMol script viewer  CIT 235A  ..                             | |    | |                       ..     * *                        |                               ||                                                                                  |   *          
JMol viewer RasMol script viewer  CIT 234A  ..                  **         | |    | |                       ..     | |                        |                          **   ||                                                                                  |   |          
sec str:  .........eeeeeeeeeee..eeeeeeeeeeee....eeeeeeeeee......hhhhhhhhh........ee.......hhhhh...eeeeeeeee....eeeeeeeeeee..eeeeeeeeeee............eeee..eeeeeeee..eeeeeeeeeeee....eeeeeeeeeeee..hhhhh.....eeeeeeeeeeeee....eeeeeeeeeee........
sequence :  ..SELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYG..SKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKL
seq num:  ..2         12        22        32        42        52          ..66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |           | |  |     |  | |  | | | |   |  |     |  |     ..     ^***      | || ||      | |||||   |    |  |          |  ||  |   ||||              |    |                   | || | |  |              || |  ||| |         | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |           | |  |     |  | |  | | ^**   |  |     |  |     ..               | || ||      | |||||   |    |  |          |  ||  |   ||||              |    |                   ^**^** |  |              || |  ||| |         | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..** |           | |  |     ^*** |  | |       |  |     |  |     ..               | ^***|      ^***|||   |    ^***          |  ||  |   ||||              |    |                      | | |  |              || |  |^***         | |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |           | |  |          |  | |       |  |     |  |     ..               | ||  |        | |||   |                  |  ||  |   ||||              |    |                      | | |  |              |*******^           | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |           ^*****          |  | |       |  |     |  |     ..               | ||  |        | |^*****                  |  ||  |   ||||              ^*****                      | | |  |              || |  |||           | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |             |  |          |  | |       |  |     |  |     ..               | *****        | |||                      |  ||  |   ||||                                          | | |  |              || |  |||           | |    
search RasMol script viewer Motif-ligand binding stats  betabulge .. | |             |  |          |  | |       |  |     |  |     ..               |  |           | |||                      |  ||  |   ||||                                          | | |  |              ** |  |**           | |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. | |             |  |          ******       |  |     |  |     ..               |  |           *****                      |  ||  |   ||||                                          | | |  |                 ******           | |    
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |             ****             | |       |  |     ****     ..               |  |           ****|                      |  ||  |   ||||                                          | | |  |                    | |           | |    
search RasMol script viewer Motif-ligand binding stats  nest .. | |                              ***       |  |              ..               |  |             ***                      |  ||  |   ****                                          | | |  |                    ***           | |    
search RasMol script viewer Motif-ligand binding stats  niche .. ***                                        ****              ..               ****                                      ********    ***                                          *** ****                                  ***    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                              ..                                                                                                                  ***                                              

chain B : FAR-RED FLUORESCENT PROTEIN MKATE
member of: CATH:search2.40.155.10
JMol viewer RasMol script viewer  GOL 237B  ..                                                              ..                                *                            * ***                                                                                                 
JMol viewer RasMol script viewer  CIT 236B  ..  *                                                           ..                   *            |           * **             | |||                                                                                                 
JMol viewer RasMol script viewer  CIT 235B  ..  |               **                                          ..                   |            |           | ||           **| |||                                                                                                 
JMol viewer RasMol script viewer  CIT 236A  ..  |               ||                                          ..                   |            |           | ||           ||| |||                                                                                                 
sec str:  .........eeeeeeeeeee..eeeeeeeeeeee....eeeeeeeeee......hhhhhhhhh........ee.......hhhhh...eeeeeeeee....eeeeeeeeeee..eeeeeeeeeee............eeee..eeeeeeee..eeeeeeeeeeee....eeeeeeeeeeee..hhhhh.....eeeeeeeeeeeee....eeeeeeeeeee........
sequence :  ..SELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYG..SKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKL
seq num:  ..2         12        22        32        42        52          ..66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |             | |  |     |  |    | | | |   || |     |  |     ..     ^***    | | || |       |  ||||   |    |  |          |  ||  |   ||||              |    |                   | || | |  |               | |  ||| |         | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |             | |  |     |  |    | | ^**   || |     |  |     ..             | | || |       |  ||||   |    |  |          |  ||  |   ||||              |    |                   ^**^** |  |               | |  ||| |         | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**             | |  |     ^***    | |       || |     |  |     ..             | | ^***       ^***|||   |    ^***          |  ||  |   ||||              |    |                      | | |  |               | |  |^***         | |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..               | |  |             | |       || |     |  |     ..             | | ||             |||   |                  |  ||  |   ||||              |    |                      | | |  |               *******^           | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..               ^*****             | |       || |     |  |     ..             | | ||             |^*****                  |  ||  |   ||||              ^*****                      | | |  |                 |  |||           | |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 |  |             | |       ** |     |  |     ..             | | ||             | |                      |  ||  |   ||||                                          | | |  |                 |  |**           | |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                 |  |             | |       |  |     |  |     ..             | | ||             | |                      |  ||  |   ||||                                          | | |  |                 ******           | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 ****             | |       |  |     ****     ..             | | ||             | |                      |  ||  |   ||||                                          | | ****                    | |           | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                                  ***       |  |              ..             | | ||             ***                      |  ||  |   ****                                          | | |  |                    ***           | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                            ****              ..             | ****                                      ********                                                 *** ****                                  ***    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                              ..             *****                                                                                                | |                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                              ..                                                                                                                  ***                                              

   New search    3bx9:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors