triangle PDBeMotif: 3bfo  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.22.
Classification hydrolase    | release date: Thu, Nov 22, 2007
Title crystal structure of ig-like c2-type 2 domain of the human mucosa-associated lymphoid tissue lymphoma translocation protein 1
Authors A.BOCHKAREV, A.M.EDWARDS, C.H.ARROWSMITH, D.R.LITTLER, J.R.WALKER, J.WEIGELT, M.AKUTSU, S.DHE-PAGANON, STRUCTURAL GENOMICS CONSORTIUM (SGC), Y.LI
Method X-RAY DIFFRACTION (resolution: 1.15Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKK
VEIIIDELNNL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MUCOSA-ASSOCIATED LYMPHOID TISSUE LYMPHOMATRANSLOCATION PROTEIN 1 (ISOFORM 2);
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR22576/searchPTHR22576_SF20PFAM:searchPF13895PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ9UDY8
sec str:  .....eeee....eee.....eeee.eee.....eeeeee..ee.......eeee...hhhhheeeeeeee....eee...eeeee.
sequence :  ..SKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIID
seq num:  ..225       235       245       255       265       275       285       295       305  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          ^** |  |                   |  | |  |^**|       |  ||    |  |  |   ^**      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |                   |  | |  | | |       |  |^*****  |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****                   **** **** | |       |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..              ****                             ***       ****        ****            

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : MUCOSA-ASSOCIATED LYMPHOID TISSUE LYMPHOMATRANSLOCATION PROTEIN 1 (ISOFORM 2);
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR22576/searchPTHR22576_SF20PFAM:searchPF13895PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ9UDY8
sec str:  .....eeee....eee.....eeee.eee.....eeeeee..ee.......eeee...hhhhheeeeeeee....eee...eeeee.
sequence :  ..SKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIID
seq num:  ..225       235       245       255       265       275       285       295       305  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          ^** |  |                   |  | |  |^**|       |  ||    |  |  |   ^**      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |                   |  | |  | | |       |  |^*****  |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****                   **** **** | |       |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..              ****                             ***       ****        ****            

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : MUCOSA-ASSOCIATED LYMPHOID TISSUE LYMPHOMATRANSLOCATION PROTEIN 1 (ISOFORM 2);
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR22576/searchPTHR22576_SF20PFAM:searchPF13895PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ9UDY8
sec str:  .....eeee....eee.....eeee.eee.....eeeeee..ee.......eeee...hhhhheeeeeeee....eee...eeeee.
sequence :  ..SKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIID
seq num:  ..225       235       245       255       265       275       285       295       305  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          ^** |  |                        |  |^**|       |  ||    |  |  |   ^**      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |                        |  | | |       |  |^*****  |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****                        **** | |       |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..              ****                           *****       ****        ****            

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : MUCOSA-ASSOCIATED LYMPHOID TISSUE LYMPHOMATRANSLOCATION PROTEIN 1 (ISOFORM 2);
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR22576/searchPTHR22576_SF20PFAM:searchPF13895PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ9UDY8
sec str:  .....eeee....eee.....eeee.eee.....eeeeee..ee.......eeee...hhhhheeeeeeee....eee...eeeee.
sequence :  ..SKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIID
seq num:  ..225       235       245       255       265       275       285       295       305  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          ^** |  |                        |  |^**|      || |||    |  |  |   ^**      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |                        |  | | |      || ||^*****  |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****                        **** | |      *****        |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..              ****                             ***       ****        ****            

   New search    3bfo:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors