triangle PDBeMotif: 3au5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification motor protein    | release date: Fri, Jan 28, 2011
Title structure of the human myosin-x myth4-ferm cassette
Authors A.TAKAHASHI, T.HAKOSHIMA, Y.HIRANO
Method X-RAY DIFFRACTION (resolution: 2.55Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GPTRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYT
TLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSR
GILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAG
EVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVE
FAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFSFRTGSVVRQKV
EEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVY
KRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MYOSIN-X
member of: GENE3D:searchG3DSA_1.20.80.10/searchG3DSA_2.30.29.30PFAM:searchPF00169/searchPF00373/searchPF00784PROSITE PROFILES:searchPS50003/searchPS50057/searchPS51016, SMART:searchSM00139/searchSM00233/searchSM00295SUPERFAMILY:searchSSF47031/searchSSF50729UniProt:searchQ9HD67
sec str:  .....hhhhhhhhhhhh...hhhhhhhhhhhhhhhh..................hhhhhhhh...hhhhhhhhhhhhh........hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.........hhhhhhhhhh...eeeeeee...eeeeeee....hhhhhhhhhhhhh.......eeeeeee....eee.....hhhhhhhhhhhhhhh.... .....eeeeeeee..........hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.........hhhhh..hhhhhhh..hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh.......eeeeeeeee.....eeeeeee..eeeeee.......eeee...eeeeeeee..eeeeee..eeeeee..hhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQL..MSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATS... ..LPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKAR..IKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTT
seq num:  ..1501      1511      1521      1531      1541      1551      1561      1571     ..1582      1592      1602      1612      1622      1632      1642      1652      1662      1672      1682      1692      1702      1712      1722      1732      1742      1752      1762          ... ..1780      1790      1800      1810      1820      1830      1840      1850          ..1913      1923      1933      1943      1953      1963      1973      1983      1993      2003      2013      2023      2033      2043  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..               |  | |         | || | |              ||| || ||| |  ||      |  | ..  |      |   || ||| ||   |  | | |||| | ||   |       ||||||                    |  |  ||      ||||||       |  ||  | |||         |  | |   | |||  ||     | |||| | |               |  |          |   | ..PS00001..              |  ||  |               |||| |                    |  |   ||||||| |     ..      | | |  | || || |            |  | || ||  |                        |  | |     || ||   |  | || |  |  |                         | ||| 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..               |  | |         | || | |              ||| || ||| |  ||      |  | ..  |      |   || ||| ||   |  | | |||| | ||   |       ||||||                    |  |  ||      ||||||       |  ||  | |||         |  | |   | |||  ||     | |||| | |               |  |          |   | ..PS00004..              |  ||  |               |||| |                    |  |   ||||||| |     ..      | | |  | || || |            |  | || ||  |                        |  | |     || ||   |  | || |  |  |                         **^*| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..               |  | |         | || | |              ||| || ||| |  ||      |  | ..  |      |   || ||| ||   |  | | ^**| | ||   |       ||||||                    |  |  ||      |^**||       |  ||  | |||         |  ^**   | |||  ||     | |||| | |               |  |          |   | ..PS00005..              |  ||  |               |||| |                    |  |   ||||||| |     ..      ^** |  | || || |            |  | || ||  |                        |  | |     || ||   |  | |^**  |  |                         |   ^*
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..               |  | |         | || | |              ||| || ||| ^***|      |  | ..***      |   ^***|| ||   |  | | || | | ||   |       ||||||                    |  ^***|      ||||||       ^***|  | |||         |    |   | ||^***|     | |||| | |               |  |          |   | ..PS00006..              |  ||  |               |||| |                    |  |   ||||||| |     ..          ^*** || || |            |  | || |^***                        |  | |     || ||   |  | ||    |  |                         |   | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..               |  | |         | || | |              ||| || ||| |   |      |  | ..         |   ||  |*******^  | | || | | ||   |       ||||||                    |  |   |      ||||||       |   |  | |||         |    |   | |||   |     | |||| | |               |  |          |   | ..PS00007..              |  ||  |               |||| |                    |  |   ||||||| |     ..               || || |            |  | || |                            |  | *******^ ||   |  | ||    |  |                         |   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..               |  | |         | || | |              ||| || ||| |   |      |  | ..         ^*****  || ||      | | || | | ^*****       ||||||                    |  |   |      ||||||       |   |  | |||         ^*****   | |||   |     | |||| | |               |  |          |   | ..PS00008..              |  ||  |               |||| |                    |  |   ||||||| |     ..               || || |            |  | || |                            |  | |     || ||   ^*****|    |  |                         |   | 
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..               |  | |         | **********************| || ||| |   |      |  | ..         |   |   || ||      | | || | |  |           ||||||                    |  |   |      ||||||       |   |  | |||                  | |||   |     | |||| | |               |  |          |   | ..PS00029..              |  ||  |               |||| |                    |  |   ||||||| |     ..               || || |            |  | || |                            |  | |     || ||      |  |    |  |                         |   | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               |  | |         |  | | |              | | || ||| |   |      |  | ..         |   |   || ||      | | || | |  |           |*****                    |  |   |      |*****       |   |  | |||                  | |||   |     | |||| | |               |  |          |   | ..alphabetamotif..              |  ||  |               |||| |                    |  |   |*****| |     ..               || || |            |  | || |                            |  | |     || ||      |  |    |  |                         |   | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..               |  | |         |  | | |              *****| ||| |   |      |  | ..         |   |   || ||      | | || | |  |           ||||||                    |  |   |      ||||||       |   |  | |||                  | |||   |     | |||| | |               |  |          |   | ..asxmotif..              |  ||  |               |||| |                    |  |   ||||||| |     ..               || || |            |  | || |                            |  | |     || ||      |  |    |  |                         |   | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..               |  ***         |  | | |              ***  | ||| |   |      |  | ..         |   |   || ||      | | || | |  |           ||||||                    |  |   |      ||||||       |   |  | |||                  ***||   |     | |||| | |               |  |          |   | ..asxturn..              |  ||  |               |||| |                    |  |   ||||||| |     ..               || || |            |  | || |                            |  | |     || ||      |  |    |  |                         |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..               ****           **** | |                   ****| |   |      **** ..         |   |   *****      | | || | ****           *****|                    |  |   |      *****|       |   |  ****|                  |  ||   |     ****|| | |               ****          |   | ..betaturn..              |  ||  |               |||| |                    |  |   *****|| |     ..               *******            |  ******                            **** |     ****|      |  |    ****                         |   | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               |  |           |  | | |                     | | |   |           ..         |   |              | | || | |  |           | | ||                    |  |   |        |  |       |   |    | |                  |  ||   |       |||| | |               |  |          |   | ..gammaturn..              |  ||  |               |||***                    |  |     |  || |     ..                | || |            |  | || |                               | |      |  |      |  |                                 |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..               |  |           |  | | |                     *** |   |           ..         |   |              | | || | |  |           | | ||                    |  |   |        |  |       |   |    ***                  |  ||   |       **** | |               |  |          |   | ..nest..              |  ||  |               ****                      |  |     |  || |     ..                | || |            |  | || |                               | |      |  |      |  |                                 |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..               ****           **** ***                         |   |           ..         |   |              | ****** ****           | ****                    ****   |        ****       |   |                         ****|   |         ******               ****          |   | ..niche..              ********                                         ****     ****| |     ..                ******            *********                               ***      ****      ****                                 |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                   | |                         *****           ..         |   |              |   |                   |   |                        *****                   *****                             *****            | |                             |   | ..stmotif..                                                                            | |     ..                                                                                                                                  |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                   | |                                         ..         *****              *****                   *****                                                                                                   | |                             ***** ..ststaple..                                                                            | |     ..                                                                                                                                  ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                   ***                                         ..                                                                                                                                                            ***                                   ..stturn..                                                                            ***     ..                                                                                                                                        

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : MYOSIN-X
member of: GENE3D:searchG3DSA_1.20.80.10/searchG3DSA_2.30.29.30PFAM:searchPF00169/searchPF00373/searchPF00784PROSITE PROFILES:searchPS50003/searchPS50057/searchPS51016, SMART:searchSM00139/searchSM00233/searchSM00295SUPERFAMILY:searchSSF47031/searchSSF50729UniProt:searchQ9HD67
sec str:  ....hhhhhhhhhhhh...hhhhhhhhhhhhhhhh........................hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.......hhhhhhhhhh...eeeeeee...eeeeeee....hhhhhhhhhhh.........eeeeeee............hhhhhhhhhhhhh.... .....eeeeeeee..........hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.........hhhhh...........hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh.......eeeeeee.......eeeeee...eeeee........eeee.hhh.eeeeee..eeeee.....eeee..hhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..IDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPY..LKDKGYTTLQDEAIKIFNSLQQL..SDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAA... ..LPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKAR..MWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTT
seq num:  ..1502      1512      1522      1532      1542    ..1557      1567         ..1583      1593      1603      1613      1623      1633      1643      1653      1663      1673      1683      1693      1703      1713      1723      1733      1743      1753      1763       ... ..1780      1790      1800      1810      1820      1830      1840      1850          ..1911      1921      1931      1941      1951      1961      1971      1981      1991      2001      2011      2021      2031      2041    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              |  |  |  |||  |  |  | |           ..       |  |      || || .. |   |  ||  || | |  |   |  | | |||| | ||   |  |   ||   |   | |               |  |  ||       ||| |       |  ||  | |||         |  | |   | |||  ||    |  |||| | |               |  |          |  |..PS00001..         ||  ||| ||  |   |        || ||||                       | |   ||||||        ..        | | |  |  | || ||   |      || || || ||  |                           | | ||   |  |   |  | || |   | |       | ||              ||||| 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              |  |  |  |||  |  |  | |           ..       |  |      || || .. |   |  ||  || | |  |   |  | | |||| | ||   |  |   ||   |   | |               |  |  ||       ||| |       |  ||  | |||         |  | |   | |||  ||    |  |||| | |               |  |          |  |..PS00004..         ||  ||| ||  |   |        || ||||                       | |   ||||||        ..        | | |  |  | || ||   |      || || || ||  |                           | | ||   |  |   |  | || |   | |       | ||              **^*| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              |  |  |  |||  |  |  | |           ..       |  |      || || .. |   |  ||  || | |  |   |  | | ^**| | ||   |  |   ||   |   | |               |  |  ||       ^** |       |  ||  | |||         |  ^**   | |||  ||    |  |||| | |               |  |          |  |..PS00005..         ||  ||| ||  |   |        || ||||                       | |   ||||||        ..        ^** |  |  | || ||   |      || || || ||  |                           | | ||   |  |   |  | |^**   | |       | ||               |  ^*
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |  |  |  |||  |  |  | |           ..       ^***      || || ..**   |  ||  ^*** |  |   |  | | || | | ||   |  |   ||   |   | |               |  ^***|       ||  |       ^***|  | |||         |    |   | ||^***|    |  |||| | |               |  |          |  |..PS00006..         ||  ||| ||  |   |        || ||||                       | |   ||||||        ..            ^***  | || ||   |      || || || |^***                           | | ||   |  |   |  | ||     | |       | ||               |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..              |  |  |  |||  |  |  | |           ..                 || || ..     |  ||  ||   *******^  | | || | | ||   |  |   ||   |   | |               |  |   |       ||  |       |   |  | |||         |    |   | |||   |    |  |||| | |               |  |          |  |..PS00007..         ||  ||| ||  |   |        || ||||                       | |   ||||||        ..                  | || ||   |      || || || |                               | *******^  |   |  | ||     | |       | ||               |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |  |  |||  |  |  | |           ..                 || || ..     |  ^*****   |  |      | | || | | ^*****  |   ||   |   | |               |  |   |       ||  |       |   |  | |||         ^*****   | |||   |    |  |||| | |               |  |          |  |..PS00008..         ||  ||| ||  |   |        || ||||                       | |   ||||||        ..                  | || ||   |      || || || |                               | | ||   |  |   ^*****|     | |       | ||               |  | 
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..              |  |  |  |||  |  *****************..                 || || ..     |  ||  |    |  |      | | || | |  |   |  |   ||   |   | |               |  |   |       ||  |       |   |  | |||                  | |||   |    |  |||| | |               |  |          |  |..PS00029..         ||  ||| ||  |   |        || ||||                       | |   ||||||        ..                  | || ||   |      || || || |                               | | ||   |  |      |  |     | |       | ||               |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              |  |  *****|  |     | |           ..                 ***** ..     *****  |    |  |      | | || | |  |   |  |   ||   |   | |               |  |   |       ||  |       |   |  | |||                  | |||   |    *****|| | |               |  |          |  |..alphabetamotif..         ||  ||| ||  |   |        || ||||                       | |   |*****        ..                  | || ||   |      || || || |                               | | ||   |  |      |  |     | |       | ||               |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..              |  |  |  | |  |     | |           ..                 || || ..     |  |   |    |  |      | | || | |  |   |  |   ||   |   | |               |  |   |       ||  |       |   |  | |||                  | |||   |    |  |||| | |               |  |          |  |..asxmotif..         ||  ||| ||  |   |        || ||||                       | |   ||||||        ..                  | || |*****      || || || |                               | | ||   |  |      |  |     | |       | ||               |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..              |  |  |  | |  |     | |           ..                 || || ..     |  |   |    |  |      | | || | |  |   |  |   ||   |   | |               |  |   |       ||  |       |   |  | |||                  ***||   |    |  |||| | |               |  |          |  |..asxturn..         ||  *** ||  |   |        || ||||                       | |   ||||||        ..                  | || |           || || || |                               | | ||   |  |      |  |     | |       | ||               |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..              |  |  |  | |  |     | |           ..                 || || ..     |  |   |    |  |      | | || | |  |   |  |   ||   |   | |               |  |   |       ||  |       |   |  | |||                  |  ||   |    |  |||| | |               |  |          |  |..betabulge..         **   |  ||  |   |        || ||||                       | |   ||||||        ..                  | || |           || || || |                               | | **   |  |      |  |     | |       | ||               |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |  |  **** |  |     | |           ..                 ***** ..     ****   |    ****      | | || | |  |   |  |   ||   |   | |               |  |   |       ||  |       |   |  ****|                  |  ||   |    ****|**** |               ****          ****..betaturn..              |  |****   |        |****||                       | |   *****|        ..                  | || |           ***** ****                               | |      |  |      ****     | |       ****               **** 
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |       |  |     | |           ..                       ..        |   |              | | || | |  |   |  |   ||   |   | |               |  |   |       ||  |       |   |    ***                  |  ||   |       **** | |               |  |              ..nest..              |  ||  |   |        |  ****                       | |     |  |        ..                  | || |            |  | || |                               | |      |  |      |  |     | |       ***                     
search RasMol script viewer Motif-ligand binding stats  niche ..              ****       ****     ***           ..                       ..        |   |              | ****** ****   |  |   ||   |   | |               ****   |       |****       |   |                         ****|   |         **** |               ****              ..niche..              ********   |        |    |                        ***     ****        ..                  ******            *********                               ***      ****      ****     ***                               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                  | |           ..                       ..        |   |              |   |       |   |  |   ||   |   | |                  |   |       |   |       |   |                             |   |            | |                                 ..schellmannloop..                     |   |        ******                                            ..                                                                                                                                          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                  | |           ..                       ..        |   |              |   |       *****  |   ||   |   | |                  *****       |   |       *****                             *****            | |                                 ..stmotif..                     *****                                                          ..                                                                                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                  | |           ..                       ..        *****              *****              **********   | |                              *****                                                          | |                                 ..ststaple..                                                                                    ..                                                                                                                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                  ***           ..                       ..                                                           ***                                                                                             ***                                 ..stturn..                                                                                    ..                                                                                                                                          

   New search    3au5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors