triangle PDBeMotif: 3ate  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transport protein    | release date: Tue, Dec 28, 2010
Title crystal structure of the kir3.2 cytoplasmic domain (na+-free soaked in 10 mm praseodymium (iii) acetate)
Authors A.INANOBE, Y.KURACHI
Method X-RAY DIFFRACTION (resolution: 3.20Å)
PDBe Citation   
Small molecules:    search PR PR binding statistics PR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM INWARDLY-RECTIFYING CHANNEL, SUBFAMILY6;
member of: CATH:search2.60.40.1400GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF19PFAM:searchPF01007PIRSF:searchPIRSF005465PRINTS:searchKIR32CHANNEL/searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchP48542
JMol viewer RasMol script viewer  PR 3A  ..                   ..                                                                                                                                                                                 
JMol viewer RasMol script viewer  PR 2A  ..                   ..                                                                                                                                                         *  *                    
JMol viewer RasMol script viewer  PR 1A  ..                   ..                                                                                                                                                         |  |                    
sec str:  ................................eeeeee..eeeeeeee.......eeeeeeeeeee..ee.....ee...eee.................eeeeee.............hhhhh..eeeeeeeeee.....eeeeeeeee...eee.eee...eeee..eeee.hhhh..eee......hhhhhhhhhh.
sequence :  ..IQRYVRKDGKCNVHHGNVR..AETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
seq num:  ..55        65       ..202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | |||         ..            | || |                  | |        |||||    ^*** |||||||||| | |         |  | || |    |  |         |    | |         |  ||  |   | ||  |        |  |      | || |||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | |||         ..            ^**| |                  ^**        |||||         |||||||||| | |         |  | || |    |  |         |    | |         |  ||  |   | ||  |        |  |      | |^**||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |||         ..            ^*** |                             |^***         |||||^***| | |         |  | || |    |  |         |    | |         |  ||  |   | |^***        ^***      | |^***|      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |||         ..              |  |                             | |||         |||||||||| | |         |  | || |    |  |         ^***** |         |  ||  |   | |            |  |      | ||   |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |||         ..              |  |                             | |||         ***||||||| | |         |  | || |    |  |              | |         |  ||  |   | |            |  |      | ||   |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     | |||         ..              |  |                             *****          ||||||||| | |         |  | || |    |  |              | |         |  ||  |   | |            |  |      | ||   |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****|         ..              ****                             ****|          |||||**** | |         *********    |  |              | |         ****|  |   | |            ****      | ||   |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |         ..                                                 | |          ||||||||| ***         |  | |  |    |  |              | |         |  ||  |   | |            |  |      | ||   |      
search RasMol script viewer Motif-ligand binding stats  nest ..       ***         ..                                                 ***          ********|             |  | |  |    |  |              ***         |  ||  |   | |            |  |      | ||   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                   ..                                                                  |****             **** ****    ****                          ********   ***            ****      ***|   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                   ..                                                                  | |                                                                                                 *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ..                                                                  ***                                                                                                            

   New search    3ate:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors