triangle PDBeMotif: 3ata  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transport protein    | release date: Tue, Dec 28, 2010
Title crystal structure of the kir3.2 cytoplasmic domain (na+-free soaked in 10 mm barium chloride and 10 mm spermine)
Authors A.INANOBE, Y.KURACHI
Method X-RAY DIFFRACTION (resolution: 3.49Å)
PDBe Citation   
Small molecules:    search BA BA binding statistics BA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM INWARDLY-RECTIFYING CHANNEL, SUBFAMILY6;
member of: CATH:search2.60.40.1400GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF19PFAM:searchPF01007PIRSF:searchPIRSF005465PRINTS:searchKIR32CHANNEL/searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchP48542
JMol viewer RasMol script viewer  BA 1A  ..                   ..                                                                                                                                                                                 
sec str:  ................................eeeeee..eeeeeeee.......eeeeeeeeeee..ee.....ee...eeee................eeeeee.............hhhhh..eeeeeeeeee.....eeeeeeeee...eee.eee...eeee..eeee.hhhh..eee......hhhhhhhhhh.
sequence :  ..IQRYVRKDGKCNVHHGNVR..AETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
seq num:  ..55        65       ..202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |         ..            | ||                    | |        |||||    ^***   | ||||||           | |  | |  |    |  |         |    | |        || |||  |   | ||  |     |  |  |      | || ||| |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |         ..            ^**|                    ^**        |||||           | ||||||           | |  | |  |    |  |         |    | |        || |||  |   | ||  |     |  |  |      | |^**|| |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |         ..            ^***                               |^***           | |^***|           | |  | |  |    |  |         |    | |        || |||  |   | |^***     |  ^***      | |^***| |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |         ..                                               | |||           | ||||||           | |  | |  |    |  |         ^***** |        || |||  |   | |         |  |  |      | ||   | |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |         ..                                               | |||           | ||||||           | |  | |  |    |  |              | |        *****|  |   | |         |  |  |      | ||   | |  | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       | |         ..                                               *****           | ||||||           | |  | |  |    |  |              | |        || |||  |   | |         |  |  |      | ||   | |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |         ..                                               ****|           | ||||||           | **** ****    |  |              | |        ****||  |   | |         *******      | ||   | **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |         ..                                               | | |           | ||||||           ***  | |  |    |  |              | |         |  ||  |   | |            |  |      | ||   |      
search RasMol script viewer Motif-ligand binding stats  nest ..       ***         ..                                               | ***           *******|             |  | |  |    |  |              ***         |  ||  |   | |            |  |      | ||   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                   ..                                               | | |               ****             **** ****    ****                          ********   ***            ****      ***|   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                   ..                                               *****                                                                                                                  *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ..                                               ***                                                                                                                               

   New search    3ata:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors