triangle PDBeMotif: 3al3  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification dna binding protein/protein binding    | release date: Thu, Jul 22, 2010
Title crystal structure of topbp1 brct7/8-bach1 peptide complex
Authors C.C.LEUNG, J.N.GLOVER
Method X-RAY DIFFRACTION (resolution: 2.15Å)
PDBe Citation   
Small molecules:    search FMT FMT binding statistics FMT
Modified residues:  search TPO TPO binding statistics TPO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GPLGSLKKQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNEKYLASVAAGKWVLHRSYLEACR
TAGHFVQEEDYEWGSSSILDVLTGINVQQRRLALAAMRWRKKIQQRQESGIVEGAFSGWKVILHVDQSREAGFKRLLQSG
GAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFI
Chain B sequence:
SIYFTPELYD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA TOPOISOMERASE 2-BINDING PROTEIN 1
member of: GENE3D:searchG3DSA_3.40.50.10190PANTHER:searchPTHR13561/searchPTHR13561_SF25PFAM:searchPF00533PROSITE PROFILES:searchPS50172, SMART:searchSM00292SUPERFAMILY:searchSSF52113UniProt:searchQ92547
JMol viewer RasMol script viewer  FMT 1A  ..         **  *                               *                   *                                                                                                              ..FMT ..                                          
sec str:  .....eeeee...hhhhhhhhhhhhh...ee...........eeee......hhhhhhhh...eee..hhhhhhhhh......hhh....hhhh.......hhhhhhhhhhhhhhhhhhhhh............eeeee.....hhhhhhhhhh...ee.....hhh.....eeee..... .....hhhhhh...eeee.hhhhhhhh......hhhh..hhh..
sequence :  ..KQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNEKYLASVAAGKWVLHRSYLEACRTAGHFVQEEDYEWGSSSILDVLTGINVQQRRLALAAMRWRKKIQQRQESGIVEGAFSGWKVILHVDQSREAGFKRLLQSGGAKVLPGHSVPLFKEATHLFSDL... ..GVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAIS
seq num:  ..1266      1276      1286      1296      1306      1316      1326      1336      1346      1356      1366      1376      1386      1396      1406      1416      1426      1436  ... ..1450      1460      1470      1480        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                      | |||    | | | ||            |   || |||     |  |   || |   || ||  | | || |  || |                  | |||  |||| |      |  ||      || |||  |    |  |  |    | |..PS00005..|    ||| |||    |  |  |  |     || || |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                      | |||    | | | ||            |   || |||     ^***   || |   || ||  | ^*** |  || |                  | |||  |||| |      |  ||      || |||  |    |  |  |    | |..PS00006..|    ||| |||    |  |  |  |     || || |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                      | |||    | | | ||            |   || |||        |   || |   || ||  |   |  |  || |                  | |^*****|| |      |  ||      || |||  |    |  |  |    | |..PS00008..^*****|| |||    |  |  |  |     || || |  | 
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..                      | |||    | | | ||            |   || |||        |   || |   || ||  |   |  |  || |                  | |||  | || |      |  ||      || |||  *******************..PS00029..      || |||    |  |  |  |     || || |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      | |||    | | | ||            |   || |||        |   || |   || ||  |   |  |  || |                  | |||  | || |      *****      || |||       |  |  |    | |..alphabetamotif..      || |||    |  |  |  |     || || |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                      | |||    | | ***|            |   || |||        |   || |   || ||  |   |  |  |***                  | |||  | || |      |  |       || |||       |  |  |    | |..asxturn..      || |||    |  |  |  |     || || |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ****|    | | |  |            |   |****|        |   || |   ********   |  |  |                     ****|  | || |      ****       |****|       ****  |    | |..betaturn..      *****|    ****  |  |     ****| |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..                        ***    | | |  |            |   |  ***        |   |***    |  |  |   |  |  |                       ***  | || |                 |  ***          |  |    | |..nest..         ***          |  |      |  | |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                               *** ****            |   |    |        |   |       *******   *******                            ******                 |    |          ****    | |..niche..                      ****      **** **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                   |   ******        |   |                                                                           ******                  | |..schellmannloop..                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                   *****             *****                                                                                                   | |..ststaple..                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                             ***..stturn..                                          

chain B : PEPTIDE OF FANCONI ANEMIA GROUP J PROTEIN
member of: UniProt:searchQ9BX63
JMol viewer RasMol script viewer  FMT 1A  ..          
sec str:  ............
sequence :  ..SIYFTPELYD
seq num:  ..1129      
search RasMol script viewer Motif-ligand binding stats  betaturn ..****|     
search RasMol script viewer Motif-ligand binding stats  niche ..****|     
search RasMol script viewer Motif-ligand binding stats  stmotif ..*****     
search RasMol script viewer Motif-ligand binding stats  stturn ..***       

   New search    3al3:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors