triangle PDBeMotif: 3adk  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.4.3
Classification transferase(phosphotransferase)    | release date: Thu, Nov 19, 1987
Title refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution
Authors G.E.SCHULZ
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search ACE ACE binding statistics ACE   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAM
VAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPV
IAFYEKRGIVRKVNAEGSVDDVFSQVCTHLDTLK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ADENYLATE KINASE
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300HAMAP:searchMF_00235/searchMF_03171PANTHER:searchPTHR23359/searchPTHR23359_SF59PFAM:searchPF00406PRINTS:searchADENYLTKNASEPROSITE PATTERNS:searchPS00113, SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR01360UniProt:searchP00571
JMol viewer RasMol script viewer  SO4 196A  ..                                                                                                                                *  *     *          *                                             
JMol viewer RasMol script viewer  SO4 195A  ..                 *****                                                                                                          |  *     |          |                                             
JMol viewer RasMol script viewer  ACE 0A  ..** *             |||||                                                                                                          |  |     |          |                                             
sec str:  ..hhhhhhh..eeeeee....hhhhhhhhhhhhh..eeeehhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.......eeee....hhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh....eeeee...hhhhhhhhhhhhhhh..
sequence :  ..MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDDVFSQVCTHLDTLK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||  |      |  |^**||  |     | |   |  |  |   |||^** |       | |     |  |  |  ||  | ^** | |   | |  ||                       ^** |||   ^**||||  ^** |    |  |  |      ||||   | | |  |  |   | ||^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||  |      |  |||||^***     | |   ^***  |   ||||   |       | |     ^***  |  ||  |  |  | |   | |  ||                        |  |||   |||||||    | |    |  |  |      ||||   | | ^***  |   ^*** | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   ||  |      |  |||||         | |         |   ||||   |       | |           |  ||  |  |  | |   | |  ||                        |  |||   |||||||    *******^  |  |      ||||   | |       |   | |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ||  |      ^*****||         | |         |   ||^*****       | |           |  ||  |  |  | |   | |  ||                        |  |||   |||||||      |       |  |      ||||   | |       |   | |  | 
search RasMol script viewer Motif-ligand binding stats  ADENYLATE_KINASE ..   ||  |         |||||         | |         |   || |           | |           |  ||  |  |  **^***^*****|                        |  |||   |||||||      |       |  |      ||||   | |       |   | |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||  |         |||||         | |         |   || |           | |           *****  |  |          *****                        *****|   |||||||      |       |  |      ||||   | |       |   | |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ||  |         |||||         | |         |   || |           | |           |  |   |  |          |  |                         |  | |   |||||||      |       |  |      ||||   ***       |   | |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |****         |||||         | |         |   || |           | |           ****   |  |          ****                         **** |   |||||||      |       ****      ||||   | |       |   | |  | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ||  |         |||||         | |         |   || |           | |                  |  |                                            |   |***|||      |                 ||||   | |       |   | |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..   ||  |         *****         ***         |   |***           ***                  |  |                                            |   *** |||      |                 ****   | |       |   | |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..   |****            |                      |   |                                   ****                                            |     *****      |                  ***   ***       |   | **** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****            |                      *****                                                                                   |     | ||       |                                  *****      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                    *                                                                                                              *     * **       *                                             

   New search    3adk:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML