triangle PDBeMotif: 3a9l  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hydrolase    | release date: Fri, Oct 30, 2009
Title structure of bacteriophage poly-gamma-glutamate hydrolase
Authors K.KIMURA, Z.FUJIMOTO
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search PO4 PO4 binding statistics PO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MAQTDTYPNIEALENAETVGVAYNIEVKRQNPSMIYFSPHAGGIEVGTTELIYRVVELTGGSLYLFQGLLPSGNSRLHVT
STHFDEPMAVCMLSKHTDAVSFHGYKDDYNKNTLVGGLNTELRNLIVSKLNSKGIAAEVATDRFTATDPDNIVNRCASGK
GVQLEISSAQRRAFFQNNDWSKANRGNVTQEFLDYAEAIKEAEAEYYGLEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLY-GAMMA-GLUTAMATE HYDROLASE
member of: PFAM:searchPF05908UniProt:searchQ852V1
JMol viewer RasMol script viewer  PO4 261A  ..                                    *    *                                * **                     *                                                             *                                             
JMol viewer RasMol script viewer  ZN 251A  ..                                    *    *                                | ||                     *                                                             |                                             
sec str:  .......hhhhhhhhh.....eeeeeee....eeeeeeeee....hhhhhhhhhhhhhh.eeeeeee....hhhhhh.hhhhh.hhhhhhhhhh..eeeeeeee.......eeee..hhhhhhhhhhhhhhh....ee...........hhhhhh.....eeeeeehhhhhhhhhhhh.hhhhh...hhhhhhhhhhhhhhhhhhhhhh
sequence :  ..TDTYPNIEALENAETVGVAYNIEVKRQNPSMIYFSPHAGGIEVGTTELIYRVVELTGGSLYLFQGLLPSGNSRLHVTSTHFDEPMAVCMLSKHTDAVSFHGYKDDYNKNTLVGGLNTELRNLIVSKLNSKGIAAEVATDRFTATDPDNIVNRCASGKGVQLEISSAQRRAFFQNNDWSKANRGNVTQEFLDYAEAIKEAEAEYYGLE
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |   ||  |  | || |     |  |   | |  | | |||     |   | |      | |  ||| ||  || ||      || ||          |  |     |    |        || |||     | |||||| || |  | | |      |   ||  |  || || || ^***         |    | ||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |   ||  |  | || |     |  |   | |  | | |||     |   | |      | |  ||| ||  || ||      || ||          |  |     |    |        || |||     ^**||||| || |  | ^**      |   ||  |  || || || |            |    | ||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |   ||  |  | || |     |  |   | |  | | |||     |   | |      | |  ||| ||  |^***      || ||          |  |     |    |        || |||        |^*** || |  | | |      |   ||  |  || || || |            |    | ||| 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |   ||  |  | || |     |  |   | |  | | |||     |   | |      | |  ||| ||  |  |       || ||          |  |     |    |        || |||        ||||| || |  | | |      |   ||  |  || || || |            *******^|| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |   ||  |  ^*****     |  |   | |  ^*****|     |   | |      ^*****|| ||  |  |       || ||          |  |     ^*****        || |||        ||||| || |  | | |      |   ||  |  || || || |                 |  || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |   ||  |  | ||       |  |   | |    | |||     |   | |      | |  ||| ||  |  |       || ||          |  |                   || |||        ||||| || |  | | |      |   ||  |  || ***** |                 ***** 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     *****|  |  | ||       |  |   | |    | |||     |   | |      | |  ||| ||  |  |       || ||          |  |                   || |||        ||||| || |  | | |      |   ||  |  || || || |                 |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |  | ||       |  |   | |    | |||     |   | |      | |  ||| ||  |  |       || ||          |  |                   || |||        ||||******  | | |      |   ||  |  || || || |                 |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |  | ||       |  |   | |    ****|     |   | |      | |  |****|  |  |       ****|          |  |                   *****|        |||||  | |  | | |      |   ||  ****| ***** |                 ****  
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |  ***|       |  |   | |      ***     |   ***      | |  ***  |  |  |        |  |          |  |                   |  ***        *****  | |  | ***      |   ||  |   | |  |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..          ****  ****       ****   | |              |   | |      ***    ****  ****        ****          ****                   |    |          ****** **** | |      |   |****   ***  ****                       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                  | |              |   | |                                                                    ******                      | |      |   |                                       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                  | |              |   | |                                                                                                | |      *****                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                  | |              ***** |                                                                                                | |                                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                  ***                  ***                                                                                                ***                                                  

chain B : POLY-GAMMA-GLUTAMATE HYDROLASE
member of: PFAM:searchPF05908UniProt:searchQ852V1
JMol viewer RasMol script viewer  PO4 261B  ..                                    *    *                                * **                     *                                                             *                                             
JMol viewer RasMol script viewer  ZN 251B  ..                                    *    *                                | ||                     *                                                             |                                             
sec str:  .......hhhhhhhhh.....eeeeeee....eeeeeeeee....hhhhhhhhhhhhhh.eeeeeee....hhhhhh.hhhhh.hhhhhhhhhh..eeeeeeee.......eeee..hhhhhhhhhhhhhhh....ee...........hhhhhh.....eeeeeehhhhhhhhhhhh.hhhhh...hhhhhhhhhhhhhhhhhhhh..
sequence :  ..TDTYPNIEALENAETVGVAYNIEVKRQNPSMIYFSPHAGGIEVGTTELIYRVVELTGGSLYLFQGLLPSGNSRLHVTSTHFDEPMAVCMLSKHTDAVSFHGYKDDYNKNTLVGGLNTELRNLIVSKLNSKGIAAEVATDRFTATDPDNIVNRCASGKGVQLEISSAQRRAFFQNNDWSKANRGNVTQEFLDYAEAIKEAEAEYYGLE
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |   || ||  | || |     | ||   | |  | | |||     |   | |      | |  | |  | |||||||      |  |          | ||     |    |           | |     | ||||||  | |  | |||      |   || |||  | |  |  ^***         |      |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |   || ||  | || |     | ||   | |  | | |||     |   | |      | |  | |  | |||||||      |  |          | ||     |    |           | |     ^**|||||  | |  | ^**      |   || |||  | |  |  |            |      |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |   || ||  | || |     | ||   | |  | | |||     |   | |      | |  | |  | ||^***|      |  |          | ||     |    |           | |        |^***  | |  | |||      |   || |||  | |  |  |            |      |  |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |   || ||  | || |     | ||   | |  | | |||     |   | |      | |  | |  | || || |      |  |          | ||     |    |           | |        |||||  | |  | |||      |   || |||  | |  |  |            *******^  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |   || ||  ^*****     | ||   | |  ^*****|     |   | |      ^***** |  | || || |      |  |          | ||     ^*****           | |        |||||  | |  | |||      |   || |||  | |  |  |                   |  |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |   *****  | ||       | ||   | |    | |||     |   | |      | |  | |  | ***** |      |  |          | ||                      | |        |||||  | |  | |||      |   || |||  | |  |  |                   |  |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     *****| ||  | ||       | ||   | |    | |||     |   | |      | |  | |  | || || |      |  |          | ||                      | |        |||||  | |  | |||      |   || |||  | |  |  |                   |  |
search RasMol script viewer Motif-ligand binding stats  asxturn ..         || ||  | ||       ***|   | |    | |||     |   | |      | |  | |  | || || |      |  |          ***|                      | |        |||||  ***  | |||      |   || |||  | |  |  |                   |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|  | ||       |  |   | |    ****|     |   | |      | |  | |  | ****| |      |  |          |  |                      | |        ||||**** |  ****|      |   ****|**** |  |  |                   ****
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |  ***|       |  |   | |      ***     |   ***      | |  ***  |  |  | |      |  |          |  |                      ***        *****  | |  | ***      |   ||  |   | |  |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..          ****  ****       ****   | |              |   | |      ***    ****  ******      ****          ****                                   ****** **** | |      |   |****   ***  ****                       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                  | |              |   | |                                                                                                | |      *****                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                  | |              ***** |                                                                                                | |                                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                  ***                  ***                                                                                                ***                                                  

   New search    3a9l:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors