triangle PDBeMotif: 2ypa  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification immune system    | release date: Tue, Oct 30, 2012
Title structure of the scl:e47:lmo2:ldb1 complex bound to dna
Authors C.PORCHER, D.KARIA, E.J.MANCINI, E.PONSELE, K.EL OMARI, K.TULADHAR, O.PLAT, P.VYAS, R.PATIENT, S.J.HOOSDALLY
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSQDPEISDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKL
LNDQEEEGTQR
Chain B sequence:
MADLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPK
AA
Chain C sequence:
MGSSHHHHHHSQDPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQD
GLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKING
Chain D sequence:
GGSGGHMGSGGDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL ACUTE LYMPHOCYTIC LEUKEMIA PROTEIN 1
member of: GENE3D:searchG3DSA_4.10.280.10PANTHER:searchPTHR13864/searchPTHR13864_SF16PFAM:searchPF00010PROSITE PROFILES:searchPS50888, SMART:searchSM00353SUPERFAMILY:searchSSF47459UniProt:searchP17542
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..PHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEE
seq num:  ..182       192       202       212       222       232       242    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                            || ||   |  **^*  |                |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                            || ||   |  |  |  |                |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                            || ||   |  |  ^***                |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                            *****   |  |                      |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****   ****                      **** 

chain B : TRANSCRIPTION FACTOR E2-ALPHA
member of: GENE3D:searchG3DSA_4.10.280.10PANTHER:searchPTHR11793/searchPTHR11793_SF7PFAM:searchPF00010PROSITE PROFILES:searchPS50888, SMART:searchSM00353SUPERFAMILY:searchSSF47459UniProt:searchP15923
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..EKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPK
seq num:  ..539       549       559       569       579       589       599          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|                                     | ^**  |   |                 |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..*                                     | | |  |   |                 |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..                                      *** |  |   |                 |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                        ***  |   |                 ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                        | |  *****                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                        ***                              

chain C : RHOMBOTIN-2
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24208PFAM:searchPF00412PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP25791
JMol viewer RasMol script viewer  ZN 1159C  ..*  *                 *  *                                                                                                     
JMol viewer RasMol script viewer  ZN 1158C  ..|  |                 |  |  *  *                   *  *                                                                        
JMol viewer RasMol script viewer  ZN 1157C  ..|  |                 |  |  |  |                   |  |          *  *                  *  *                                    
JMol viewer RasMol script viewer  ZN 1156C  ..|  |                 |  |  |  |                   |  |          |  |                  |  |  *  *                  *  *        
sec str:  .............eeeee..eee....................eeee..eeehhhhhhhhhh..ee......ee....eeeee..eeee.................eeeee..eeee..hhhhhhhh.
sequence :  ..CGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKIN
seq num:  ..30        40        50        60        70        80        90        100       110       120       130       140       150   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || | | |     |  |  |  |  |  ||||| ||  |    |  |       |  |  | |  | |  |  | ^**|| | ||  |  |  | | || |     |  |      |   |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| || | | |     |  |  |  |  |  ||||| ||  |    |  |       |  |  | |  | |  |  |   ******^|  |  |  | | || |     |  |      |   |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ^***** |     |  |  |  |  |  |^*****|  |    |  |       |  |  ^***** |  |  |    || |  |  |  |  | | || |     |  |      |   |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|  | | | |     |  |  |  |  |  | ||| |^***    ^***       |  |    |  | |  |  |    || |  |  |  |  | | || |     |  |      |   |   
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..^**^*****************^**^**^**^**** |                   |  |    ^**^******************^**^**^**^****| |     |  |      |   |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | | |     ****           | ||  |                   |  |       | |  |  |    ****           | |  | |     ****      |   |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | | | |                    | ||  |                   |  |       | |  |  |     | |           | |  ***               |   |   
search RasMol script viewer Motif-ligand binding stats  nest ..   *** ***                    ***|  |                   |  |       ***  |  |     | |           ***                    |   |   
search RasMol script viewer Motif-ligand binding stats  niche ..                                 ****                   ****            ****     ***                                  |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                      *****   

chain D : LIM DOMAIN-BINDING PROTEIN 1
member of: PANTHER:searchPTHR10378/searchPTHR10378_SF7UniProt:searchQ86U70
sec str:  ...eee....ee.........ee..eeee...
sequence :  ..DVMVVGEPTLMGGEFGDEDERLITRLENTQ
seq num:  ..300       310       320       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..*          || |||| |   ^*** ^*
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****| |          
search RasMol script viewer Motif-ligand binding stats  nest ..            | |*** |          
search RasMol script viewer Motif-ligand binding stats  niche ..            *** ****          

chain E : EBOX FORWARD
sec str:  .............
sequence :  ..ACCATCTGTTC
seq num:  ..4          

chain F : EBOX REVERSE
sec str:  .............
sequence :  ..GAACAGATGGT
seq num:  ..22         

   New search    2ypa:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors