triangle PDBeMotif: 2y33  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.14.11.
Classification oxidoreductase    | release date: Sat, Dec 18, 2010
Title s-nitrosylated phd2 (gsno soaked) in complex with zn(ii) and
Authors C.J.SCHOFIELD, I.J.CLIFTON, R.CHOWDHURY
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search UN9 UN9 binding statistics UN9
Modified residues:  search SNC SNC binding statistics SNC
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSHMASPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGD
KITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDW
DAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVEL
NKPSDSVGKDVF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EGL NINE HOMOLOG 1
member of: PANTHER:searchPTHR12907/searchPTHR12907_SF4PFAM:searchPF13640PROSITE PROFILES:searchPS51471, SMART:searchSM00702UniProt:searchQ9GZT9
JMol viewer RasMol script viewer  UN9 901A  ..                                                                  * *                                          *   *      *  * *             *             *                              * *      *                    
JMol viewer RasMol script viewer  ZN 900A  ..                                                                  | |                                          |   |      |  * *             |             |                              * |      |                    
sec str:  ...hhhhhhhhhhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhhh.......eee........ee..eeeee......hhhhhhhhhhhhhhhhh.........eeee..eeeeee......eeee........eeeeeeee.....hhhhhh..eee........eee.....eeeeee......eee......eeeeeeeeeehhhhhhhhhhh
sequence :  ..LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKY
seq num:  ..188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                 | |    | |    |    |   | | ||||  |  |||| || || | |  |  |||| |||  ||  || |  || |||||||||             |^***|       |||||||    | |   |  ||        | |        |  |     ||||||                              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                 | |    | |    |    |   | | ^**|  |  |^** |^**| | |  |  |||| |||  ||  || |  || ||||||^**             |||| |       |||||||    | |   |  ||        | |        |  |     ^**|||                              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 | |    | |    |    |   | | ||||  |  |||| |^*** | |  ^***||| |||  ||  ^***  || |||||| |              |||| |       |||||||    | |   |  ||        | |        |  |      | |||                              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 | |    | |    ^*****   | | ||||  ^*****| ||  | | |     |||| |||  ^*****    || |||||| |              ^*****       |||||||    | |   |  ||        | |        |  |      | |||                              
search RasMol script viewer Motif-ligand binding stats  RGD ..                 | |    | |             | | ||||     || | ||  | ***     |||| |||  ||  ||    || |||||| |              |||| |       |||||||    | |   |  ||        | |        |  |      | |||                              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 | |    | |             | | ||||     || | ||  |         |||| |||  ||  ||    *****|||| |              |||| |       |||||||    | |   *****        | |        |  |      | |||                              
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                 | |    | |             | | ||||     || | ||  |         |||| |||  ||  ||    || |||||| |              |||| |       |||||||    | |   |  |         | |        |  |      *****                              
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 | |    | |             | | ||||     || | ||  |         |||| |||  ||  ||    || |||||| |              |||| |       ||***||    | |   |  |         | |        |  |      ***|                               
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 | |    | |             | | ||||     ** | ||  |         |||| |||  ||  ||    || |||||| |              |||| |       |||||**    | |   |  |         | |        |  |      |  |                               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 | |    | |             | ****||        | ||  |         |||****|  ||  ||    ***********              |||| |       |||||      | |   ****         | |        |  |      ****                               
search RasMol script viewer Motif-ligand binding stats  nest ..                 ***    ***             |   ****        | ||  |         **** ***  ||  ||     |  |***| |              **** |       *****      | |                | |        |  |                                         
search RasMol script viewer Motif-ligand binding stats  niche ..                                        |   |***        *******          ***      ||  ||     ****   ***                   |                  ***                ***        ****                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                        *****                                     ******                                  |                                                                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                          *                                                                                             

   New search    2y33:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors