triangle PDBeMotif: 2y05  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.3.1.   1.3.1.48   1.3.1.74
Classification oxidoreductase    | release date: Tue, Nov 30, 2010
Title crystal structure of human leukotriene b4 12-hydroxydehydrog complex with nadp and raloxifene
Authors A.C.W.PIKE, A.EDWARDS, C.ARROWSMITH, C.BOUNTRA, C.JOHANSSON, F.VON DELFT, J.WEIGELT, N.SHAFQAT, P., R.SETHI, T.KROJER, U.OP, W.W.YUE
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search RAL RAL binding statistics RAL   search NAP NAP binding statistics NAP   search CL CL binding statistics CL   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
SMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPK
GTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQI
AKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGA
ISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDN
LGKTIVKA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROSTAGLANDIN REDUCTASE 1
member of: CATH:search3.40.50.720/search3.90.180.10GENE3D:searchG3DSA_3.40.50.720/searchG3DSA_3.90.180.10PANTHER:searchPTHR11695/searchPTHR11695_SF5PFAM:searchPF00107SUPERFAMILY:searchSSF50129/searchSSF51735TIGRFAMS:searchTIGR02825UniProt:searchQ14914
JMol viewer RasMol script viewer  EDO 1332A  ..                                                                                                                             *                                                                                                                                                ** *    *                                                 
JMol viewer RasMol script viewer  EDO 1331A  ..                                                                                                                             |                                                                                                       **                              *        || |    |                                                 
JMol viewer RasMol script viewer  CL 1330A  ..                                                                *                   ***                                      |                                                                                                       ||                              |        || |    |                                                 
JMol viewer RasMol script viewer  RAL 801A  ..                                               *  *   *         |                   ||*                                      |                                                                                                       ||                              |        |* |    |                                                 
JMol viewer RasMol script viewer  NAP 701A  ..                                              *|  |   |         |                   |||                                   *  |*                       ***                  **   *              *                       **            ||      ** ** *                 |      ***| |    |                                   ** * *        
sec str:  ...eeeeeee........hhh.eeeeeee........eeeeeeeee..hhhhhhhhhh.........eeeeeeee.........eeee......eeee.....ee.........hhhhhhh..hhhhhhhhhhhhh........eeee....hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhh..eeee.....hhhhhhhhhh...eeeeee..hhhhhhhhhh.eeeeeeeee..hhhhhh.........hhhhhhhh..eeee.hhhhhhhhhhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhh.....eeeee.
sequence :  ..SMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |       || ||          |  |     ||    |  |  |  ||  |   |    |         |  |      | |  | ||||||   |  ||  |  || ||                |||   |     | ||    |    || |||   |    |      | |||    ||| | |  || | ||           |    | || |||  |     |   ||^***          || |||       | |              || ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..      | |       || ||          |  |     ||    |  |  |  ||  |   |    |         |  |      | |  | ||||||   |  ||  |  || ||                |||   |     | ||    |    || |||   |    |      | |||    ||| | |  || **^*           |    | || |||  |     |   || |            || |||       | |              || ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      ^**       || ||          |  |     ||    |  |  |  ||  |   |    |         |  |      | |  | ||||||   |  ||  |  || ||                |||   |     | ||    |    || |||   |    |      | |||    ||| | |  |^**  |           |    | || |||  |     |   || |            || |||       | |              || ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                ^***|          |  |     ||    |  |  |  ||  |   |    |         |  |      | |  ^***||||   |  ||  |  || ||                |||   |     | ||    |    || |||   |    |      | |||    ||| | ^***| |  |           |    | || |||  |     |   || |            || |||       | |              || ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |  |          |  |     ||    |  |  |  ||  |   ^*****         |  |      | |    ||||||   |  ||  |  || ||                |^*****     | |^*****    || |||   ^*****      | |||    ||| | |   | |  |           ^***** || |||  |     ^***** |            || |||       | |              || ||||        |  |      ^*****|        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 |  |          |  |     ||    |  |  |  ||  |                  |  |      | |    ||||||   |  ||  |  || ||                | |         | ||         || |||               | |||    ||| | |   | |  |                  *****|  |         |  |            || |||       | |              || ||||        |  |       | ||||        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 |  |          |  |     ||    |  |  |  ||  |                  |  |      | |    ||||||   |  ||  |  || ||                | |         | ||         || |||               | |||    *** | |   | |  |                  || |||  |         |  |            || |||       | |              || ||||        |  |       | ||||        
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 |  |          |  |     **    |  |  |  ||  |                  |  |      | |    ||||||   |  ||  |  || ||                | |         | ||         || |||               | |||     |  | |   | |  |                  || |||  |         |  |            || |||       | |              || ||||        |  |       | ||||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |  |          ****           ****  |  |****                  |  |      | |    ||||||   |  ||  |  *****                | |         | ||         |****|               ****|     |  | |   | |  |                  ****|****         |  |            |****|       | |              |****||        ****       ****||        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |  |          |  |                 |  ||  |                  |  |      ***    ||||||   |  ||  |                       | |         | ||         |  | |                 | |     |  | |   | |  |                   |  ||  |         |  |            |  | |       | |              |  ||||                     ||||        
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  |          |  |                 |  ||  |                  |  |             |****|   |  ||  |                       ***         ***|         |  ***                 ***     |  | |   | |  |                   |  ||  |         |  |            |  ***       | |              |  ****                     ****        
search RasMol script viewer Motif-ligand binding stats  niche ..                 ****          ****                 ********                  ****             | ****   ********                                   ****         |    |                         **** |   | ****                   ********         ****            |    |       ***              |    |                       ***        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                               | |                                                              ******                              |   |                                                         ******                        ******                                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                               | |                                                                                                  *****                                                                                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                               ***                                                                                                                                                                                                                                      

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PROSTAGLANDIN REDUCTASE 1
member of: CATH:search3.40.50.720/search3.90.180.10GENE3D:searchG3DSA_3.40.50.720/searchG3DSA_3.90.180.10PANTHER:searchPTHR11695/searchPTHR11695_SF5PFAM:searchPF00107SUPERFAMILY:searchSSF50129/searchSSF51735TIGRFAMS:searchTIGR02825UniProt:searchQ14914
JMol viewer RasMol script viewer  EDO 1332B  ..                                                                *                    **            * *                                                                                                                                                                                                                                  
JMol viewer RasMol script viewer  CL 1331B  ..                                                                |                    ||            | |                                                                                                                                                                                         **                                       
JMol viewer RasMol script viewer  CL 1330B  ..                                                                |                    ||           *| |                                                                                                                                                                                         ||                                       
JMol viewer RasMol script viewer  RAL 802A  ..                                **                              |        ***         ||         * || |                                                                                                                                                                                         ||                                       
sec str:  ...eeeeeee........hhh.eeeeeee........eeeeeeeee..hhhhhhhhhh.........eeeeeeee.........eeee......eeee.....ee.........hhhhhhh..hhhhhhhhhhhhh........eeee....hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhh..eeee.....hhhhhhhhhh...eeeeee..hhhhhhhhhh.eeeeeeeee..hhhhh..........hhhhhhhh..eeee.hhhhhhhhhhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhh.....eeeee.
sequence :  ..SMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |       || ||          |  |     ||          |  ||  |   |    |     | |||  |      | |  | ||||||   |  ||  |  || ||                |||   |     | ||   ||    || |||   |   ||  |   | |||    ||| | |  || | ||           |    | || |||  |     |   ||^***             | |      |  |                 ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..      | |       || ||          |  |     ||          |  ||  |   |    |     | |||  |      | |  | ||||||   |  ||  |  || ||                |||   |     | ||   ||    || |||   |   ||  |   | |||    ||| | |  || **^*           |    | || |||  |     |   || |               | |      |  |                 ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      ^**       || ||          |  |     ||          |  ||  |   |    |     | |||  |      | |  | ||||||   |  ||  |  || ||                |||   |     | ||   ||    || |||   |   ||  |   | |||    ||| | |  |^**              |    | || |||  |     |   || |               | |      |  |                 ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                ^***|          |  |     ||          |  ||  |   |    |     | |||  |      | |  ^***||||   |  ||  |  || ||                |||   |     | ||   ||    || |||   |   ||  |   | |||    ||| | ^***|                |    | || |||  |     |   || |               | |      |  |                 ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |  |          |  |     ||          |  ||  |   ^*****     | |||  |      | |    ||||||   |  ||  |  || ||                |^*****     | |^*****    || |||   ^*****  |   | |||    ||| | |   |                ^***** || |||  |     ^***** |               | |      |  |                 ||||        |  |      ^*****|        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 |  |          |  |     ||          |  ||  |              | |||  |      | |    ||||||   |  ||  |  || ||                | |         | ||   |     || |||       |   |   | |||    ||| | |   |                       *****|  |         |  |               | |      |  |                 ||||        |  |       | ||||        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                 |  |          |  |     ||          |  ||  |              *****  |      | |    ||||||   |  ||  |  || ||                | |         | ||   |     || |||       |   |   | |||    ||| | |   |                       || |||  |         |  |               | |      |  |                 ||||        |  |       | ||||        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 |  |          |  |     ||          |  ||  |              ***||  |      | |    ||||||   |  ||  |  || ||                | |         | ||   |     || |||       |   |   | |||    *** | |   |                       || |||  |         |  |               | |      |  |                 ||||        |  |       | ||||        
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 |  |          |  |     **          |  ||  |              |  ||  |      | |    ||||||   |  ||  |  || ||                | |         | ||   |     || |||       |   |   | |||     |  | |   |                       || |||  |         |  |               | |      |  |                 ||||        |  |       | ||||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |  |          ****                 |  ||  |              ********      | |    ||||||   |  ||  |  *****                | |         | ||   |     |****|       |   |   ****|     |  | |   |                       ****|****         |  |               | |      |  |                 ||||        ****       ****||        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |  |          |  |                 |  ||  |                  |  |      ***    ||||||   |  ||  |                       | |         | ||   |     |  | |       |   |     | |     |  | |   |                        |  ||  |         |  |               | |      |  |                 ||||                     ||||        
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  |          |  |                 |  ||  |                  |  |             |****|   |  ||  |                       ***         ***|   |     |  ***       |   |     ***     |  | |   |                        |  ||  |         |  |               ***      |  |                 ****                     ****        
search RasMol script viewer Motif-ligand binding stats  niche ..                 ****          ****                 ********                  ****             | ****   ********                                   ****   |     |    |       |   |             **** |   |                        ********         ****                        ****                                           ***        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                               | |                                                    |   |     ******       |   |                  |   |                                                                                                                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                               | |                                                    |   |                  *****                  *****                                                                                                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                               | |                                                    *****                                         *****                                                                                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                               ***                                                                                                                                                                                                                                      

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : PROSTAGLANDIN REDUCTASE 1
member of: CATH:search3.40.50.720/search3.90.180.10GENE3D:searchG3DSA_3.40.50.720/searchG3DSA_3.90.180.10PANTHER:searchPTHR11695/searchPTHR11695_SF5PFAM:searchPF00107SUPERFAMILY:searchSSF50129/searchSSF51735TIGRFAMS:searchTIGR02825UniProt:searchQ14914
JMol viewer RasMol script viewer  CL 1333C  ..                                                         *                                                                                                                                                                                                                                                                              
JMol viewer RasMol script viewer  EDO 1332C  ..                                                         |                                                                                                                                          ***                                                                                                                                 
JMol viewer RasMol script viewer  EDO 1331C  ..                                                         |                          *                * **           *   **                                                                          |||                                                                                   *                                             
JMol viewer RasMol script viewer  EDO 1330C  ..                                                         |                          |                | ||           |   ||                                                                          |||                                                                           ****    |                                             
JMol viewer RasMol script viewer  NAP 701C  ..                                              *          |                          |                | ||           |   ||*   *                       ***                  **   *              *    |||                **                    ** ** *                        ***   ||||    |                               ** * *        
sec str:  ...eeeeeee........hhh.eeeeeee........eeeeeeeee..hhhhhhhhhh.........eeeeeeee.........eeee......eeee.....ee.........hhhhhhh..hhhhhhhhhhhhh........eeee....hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhh..eeee.....hhhhhhhhhh...eeeeee..hhhhhhhhhh.eeeeeeeee..hhhhh..........hhhhhhhh..eeee.hhhhhhhhhhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhh.....eeeee.
sequence :  ..SMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |       || ||          |  |     ||          |  ||  |   |    |     | |||  |           | ||||||   |  ||  |  || ||                |||   |     | ||   ||    || |||   |   ||  |  || |||    ||| | |  || | ||  |        |    | || |||  |     |   ||^***          || |||      |  |              || ||||                  |  ||||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..      | |       || ||          |  |     ||          |  ||  |   |    |     | |||  |           | ||||||   |  ||  |  || ||                |||   |     | ||   ||    || |||   |   ||  |  || |||    ||| | |  || **^*  |        |    | || |||  |     |   || |            || |||      |  |              || ||||                  |  ||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      ^**       || ||          |  |     ||          |  ||  |   |    |     | |||  |           | ||||||   |  ||  |  || ||                |||   |     | ||   ||    || |||   |   ||  |  || |||    ||| | |  |^**  |  |        |    | || |||  |     |   || |            || |||      |  |              || ||||                  |  ||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                ^***|          |  |     ||          |  ||  |   |    |     | |||  |           ^***||||   |  ||  |  || ||                |||   |     | ||   ||    || |||   |   ||  |  || |||    ||| | ^***  |  |  |        |    | || |||  |     |   || |            || |||      |  |              || ||||                  |  ||||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                || ||          |  |     ||          |  ||  |   ^*****     | |||  |             ||||||   |  ||  |  || ||                |^*****     | |^*****    || |||   ^*****  |  || |||    ||| |       |  |  |        ^***** || |||  |     ^***** |            || |||      |  |              || ||||                  ^*****|        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                || ||          |  |     ||          |  ||  |              | |||  |             ||||||   |  ||  |  || ||                | |         | ||   |     || |||       |   |  || |||    ||| |       |  |  |               *****|  |         |  |            || |||      |  |              || ||||                     ||||        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                || ||          |  |     ||          |  ||  |              *****  |             ||||||   |  ||  |  || ||                | |         | ||   |     || |||       |   |  || |||    ||| |       |  |  |               || |||  |         |  |            || |||      |  |              || ||||                     ||||        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                || ||          |  |     ||          |  ||  |              ***||  |             ||||||   |  ||  |  || ||                | |         | ||   |     || |||       |   |  || |||    *** |       |  |  |               || |||  |         |  |            || |||      |  |              || ||||                     ||||        
search RasMol script viewer Motif-ligand binding stats  betabulge ..                || ||          |  |     **          |  ||  |              |  ||  |             ||||||   |  ||  |  || ||                | |         | ||   |     || |||       |   |  || |||     |  |       |  |  |               || |||  |         |  |            || |||      |  |              || ||||                     ||||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|          |  |                 ********              ********             ||||||   ****|  |  *****                | |         ****   |     |****|       |   |  |****|     |  |       |  ****               ****||  |         |  |            |****|      |  |              |****||                     ||||        
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  |          |  |                 |  ||  |                  |  |             |****|   |  ||  |                       ***         ***|   |     |  ***       |   |  |  ***     |  |       |  |                   |  ||  |         |  |            |  ***      |  |              |  ****                     ****        
search RasMol script viewer Motif-ligand binding stats  niche ..                 ****          ****                 ********                  ****             | ****   ********                                      |   |     |    |       |   |  |    |     ****       ****                   ********         ****            |    |      ****              |    |                       ***        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                               | |                                                    |   |     ******       |   |  ******                                                                        ******                        ******                                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                               | |                                                    |   |                  *****                                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                               | |                                                    *****                                                                                                                                                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                               ***                                                                                                                                                                                                                                      

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : PROSTAGLANDIN REDUCTASE 1
member of: CATH:search3.40.50.720/search3.90.180.10GENE3D:searchG3DSA_3.40.50.720/searchG3DSA_3.90.180.10PANTHER:searchPTHR11695/searchPTHR11695_SF5PFAM:searchPF00107SUPERFAMILY:searchSSF50129/searchSSF51735TIGRFAMS:searchTIGR02825UniProt:searchQ14914
JMol viewer RasMol script viewer  EDO 1331D  ..                                                                                    *                 ***           *   *                                                                                                                                                                                                               
JMol viewer RasMol script viewer  EDO 1330D  ..                                                                *                   |**            * *|||           |   |                                                                                                                                                                                                               
JMol viewer RasMol script viewer  NAP 701D  ..                                              *                 |                   |||            | ||||           |   | *   *                       ***                  **   *              *                       **                    ** ** *                        ***                                           ** * *        
sec str:  ...eeeeeee........hhh.eeeeeee........eeeeeeeee..hhhhhhhhhh.........eeeeeeee.........eeee......eeee.....ee.........hhhhhhh..hhhhhhhhhhhhh........eeee....hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhh..eeee.....hhhhhhhhhh...eeeeee..hhhhhhhhhh.eeeeeeeee..hhhhh..........hhhhhhhh..eeee.hhhhhhhhhhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhh.....eeeee.
sequence :  ..SMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |       || ||          |  |     ||          |  ||  |   |    |     | |||  |      | |  | ||||||   |  ||  |  || ||   |   |        |||   |     | ||   ||    || |||   |   ||  |   | |||    ||| | |  || | ||  |        |    | || |||  |     ||  ||^***          || |||      |  |                 ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..      | |       || ||          |  |     ||          |  ||  |   |    |     | |||  |      | |  | ||||||   |  ||  |  || ||   |   |        |||   |     | ||   ||    || |||   |   ||  |   | |||    ||| | |  || **^*  |        |    | || |||  |     ||  || |            || |||      |  |                 ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      ^**       || ||          |  |     ||          |  ||  |   |    |     | |||  |      | |  | ||||||   |  ||  |  || ||   |   |        |||   |     | ||   ||    || |||   |   ||  |   | |||    ||| | |  |^**  |  |        |    | || |||  |     ||  || |            || |||      |  |                 ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                ^***|          |  |     ||          |  ||  |   |    |     | |||  |      | |  ^***||||   |  ||  |  || ||   |   |        |||   |     | ||   ||    || |||   |   ||  |   | |||    ||| | ^***     |  |        |    | || |||  |     ||  || |            || |||      |  |                 ||||        |  |      || ||||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                || ||          |  |     ||          |  ||  |   ^*****     | |||  |      | |    ||||||   |  ||  |  || ||   |   |        |^*****     | |^*****    || |||   ^*****  |   | |||    ||| |          |  |        ^***** || |||  |     ^***** |            || |||      |  |                 ||||        |  |      ^*****|        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                || ||          |  |     ||          |  ||  |              *****  |      | |    ||||||   |  ||  |  || ||   |   |        | |         | ||   |     || |||       |   |   | |||    ||| |          |  |               || |||  |      |  |  |            || |||      |  |                 ||||        |  |       | ||||        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                || ||          |  |     ||          |  ||  |              ***||  |      | |    |***||   |  ||  |  || ||   |   |        | |         | ||   |     || |||       |   |   | |||    *** |          |  |               || |||  |      |  |  |            || |||      |  |                 ||||        |  |       | ||||        
search RasMol script viewer Motif-ligand binding stats  betabulge ..                || ||          |  |     **          |  ||  |              |  ||  |      | |    ||||||   |  ||  |  || ||   |   |        | |         | ||   |     || |||       |   |   | |||     |  |          |  |               || |||  |      |  |  |            || |||      |  |                 ||||        |  |       | ||||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|          ****                 ********              ****|  |      | |    ||||||   ****|  |  *****   |   |        | |         | ||   |     |****|       |   |   ****|     |  |          ****               ****|****      ****  |            |****|      |  |                 ||||        ****       ****||        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |  |          |  |                 |  ||  |                  |  |      ***    ||||||   |  ||  |          |   |        | |         | ||   |     |  | |       |   |     | |     |  |                              |  ||  |         |  |            |  | |      |  |                 ||||                     ||||        
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  |          |  |                 |  ||  |                  |  |             |****|   |  ||  |          |   |        ***         ***|   |     |  ***       |   |     ***     |  |                              |  ||  |         |  |            |  ***      |  |                 ****                     ****        
search RasMol script viewer Motif-ligand binding stats  niche ..                 ****          ****                 ********                  ****             | ****   ********          |   |                       |   |     |    |       |   |             ****                              ********         ****            |    |      ****                                           ***        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                               | |                        |   |                       |   |     ******       |   |                                                                                ******                                                                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                               | |                        |   |                       |   |                  *****                                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                               | |                        *****                       *****                                                                                                                                                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                               ***                                                                                                                                                                                                                                      

   New search    2y05:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors