triangle PDBeMotif: 2y01  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification receptor    | release date: Tue, Nov 30, 2010
Title turkey beta1 adrenergic receptor with stabilising mutations and bound partial agonist dobutamine (crystal dob102)
Authors A.G., A.WARNE, C.G.TATE, G.F.X.SCHERTLER, J.G.BAKER, P.C.EDWARDS, R.MOUKHAMETZIANOV, R.NEHME
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Small molecules:    search 2CV 2CV binding statistics 2CV   search Y00 Y00 binding statistics Y00   search Y01 Y01 binding statistics Y01
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MGAELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWG
SFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQAL
KCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDRASKRKTSRVMLMREHKALKTLGIIMGV
FTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLAFPRKADRRLHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BETA-1 ADRENERGIC RECEPTOR
member of: CATH:search1.20.1070.10GENE3D:searchG3DSA_1.20.1070.10PANTHER:searchPTHR24248/searchPTHR24248_SF54PFAM:searchPF00001PRINTS:searchADRENERGICR/searchADRENRGCB1AR/searchGPCRRHODOPSNPROSITE PATTERNS:searchPS00237, PROSITE PROFILES:searchPS50262, SUPERFAMILY:searchSSF81321UniProt:searchP07700
JMol viewer RasMol script viewer  2CV 503B  ..                                                                                                                            *                                                                                ..2CV ..                                                                                 
JMol viewer RasMol script viewer  2CV 501B  ..                                                                                                                            |  *   *                                                                         ..2CV ..                                                                                 
JMol viewer RasMol script viewer  Y00 601A  ..                                                                                    *   *                                   |  |   |                                    *         *                          ..Y00 ..                            **  *               *  **  *                         
JMol viewer RasMol script viewer  2CV 505A  ..                                                                                    |   |                                   | **  *|                                    |         |                          ..2CV ..                            ||  |               |  ||  |                         
JMol viewer RasMol script viewer  2CV 504A  ..                  *                                                                 |   |                                   | ||  ||                                    |         |                          ..2CV ..                            ||  |               *  ||  |    *                    
JMol viewer RasMol script viewer  2CV 503A  ..                  |                                                                 |   |                                   | ||  ||                                    |   *     |                          ..2CV ..                            ||  |   **          |  ||  |    |                    
JMol viewer RasMol script viewer  2CV 502A  ..                  |                                                                 |   |                                   | ||  ||                                    |   |     |                          ..2CV ..           *                ||  |   ||          |  ||  |    |                    
JMol viewer RasMol script viewer  2CV 501A  ..                  |                                                                 |   |                                   | ||  ||               ** **                |  **  *|                          ..2CV ..           |                ||  |   ||          |  ||  |    |                    
JMol viewer RasMol script viewer  Y01 402A  ..                  |               *          *      *                               |  **                                 | ||  || *             || ||                |  || |  ||                          ..Y01 ..           |                ||  |   ||          |  ||  |    |                    
JMol viewer RasMol script viewer  Y01 401A  ..                  |               |          |      |                               |  || |      *  *                       * ||* |* |             || ||                |  || |  ||                          ..Y01 ..           |                ||  |   ||          |  ||  |    |                    
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhh..hhhhhhhhhhhh.
sequence :  ..AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQ... ..SRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
seq num:  ..33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233  ... ..278       288       298       308       318       328       338       348        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                               ||| |||||||| ||  |                      | |   |   ||  |  ||   ||   |        |  ||     |  ||   |          |   |     |||||| |        |  |    ||||||  ||                         ..PS00004..|| ||    |   | |  | | |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                               ||| |^**|||| ||  |                      | |   |   ||  |  ||   ||   |        |  ||     |  ||   |          |   |     |||||| |        |  |    ^**|||  ||                         ..PS00005..** ||    |   | |  | | |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                               ||| |||||||| ||  |                      | |   |   ||  ^***|   ||   |        |  ||     |  ||   |          |   |     |||||| |        |  |     | |||  ||                         ..PS00006..|  ||    |   | |  | | |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                               ||| |||||||| ||  |                      | |   ^*****  |   |   ||   |        |  ||     |  ||   |          |   |     |||||| |        |  |     | |||  ||                         ..PS00008..|  ||    |   | ^***** |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  G_PROTEIN_RECEP_F1_1 ..                               ||| |||||||| ||  |                      | |       |   |   |   |*****************|     |  ||   |          |   |     |||||| |        |  |     | |||  ||                         ..PS00237..|  ||    |   |    |   |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                               ||| |*****|| ||  |                      | |       |   |   |   ||   |        |   |     |  ||   |          |   |     |||||| |        |  |     | |||  ||                         ..alphabetamotif..*****    |   |    |   |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..                               ||| |||||||| ||  |                      | |       |   |   |   ||   |        |   |     |  ||   |          |   |     |||||| |        |  |     ***||  ||                         ..asxturn..|  |     |   |    |   |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                               ||| |*****|****  |                      | |       |   |   |   ||   |        |   |     |  ||   |          |   |     |||||| |        |  |        ||  ||                         ..betaturn..****     |   |    |   |                |  |                    **** |            
search RasMol script viewer Motif-ligand binding stats  nest ..                               ||| || |  |  |   |                      ***       |   |   |   ||   |        |   |     |  ||   |          |   |     ****|| |        |  |        ||  ||                         ..nest..         |   |    |   |                |  |                      |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..                               ||**** ****  |   |                                |   |   |   ||   |        |   |     ****|   |          |   |      *******        ****        ||  ||                         ..niche..         |   |    |   |                ****                      ****            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               ||  ||       |   |                                |   |   |   ||   |        |   |         *****          |   |                                 ||  ||                         ..stmotif..         |   |    |   |                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               ******       *****                                *****   **********        *****                        *****                                 ******                         ..ststaple..         *****    *****                                                          

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : BETA-1 ADRENERGIC RECEPTOR
member of: CATH:search1.20.1070.10GENE3D:searchG3DSA_1.20.1070.10PANTHER:searchPTHR24248/searchPTHR24248_SF54PFAM:searchPF00001PRINTS:searchADRENERGICR/searchADRENRGCB1AR/searchGPCRRHODOPSNPROSITE PATTERNS:searchPS00237, PROSITE PROFILES:searchPS50262, SUPERFAMILY:searchSSF81321UniProt:searchP07700
JMol viewer RasMol script viewer  Y00 601B  ..                                                                    **              **  **  *                                                                           *         *                                                                  **  *                  **  *                         
JMol viewer RasMol script viewer  2CV 505B  ..                                                                    ||              ||  ||  |                                  *  *  *   *                              |         |                                                                  ||  |                  ||  |                         
JMol viewer RasMol script viewer  2CV 504B  ..               *                                                    ||              ||  ||  |                                  |  |  |   |                              |         |                                                                  ||  |                  |*  |                         
JMol viewer RasMol script viewer  2CV 502B  ..               |                                                    ||              ||  ||  |                                  |  |  |   |                              |         |                  **                             *   *            ||  |                  ||  |                         
JMol viewer RasMol script viewer  Y01 402B  ..               |                             *      *               ||              || *||  |                                 ***  *   |                              |         |                  ||                             |   |            ||  |                  ||  |                         
JMol viewer RasMol script viewer  Y01 401B  ..               |                             |      |               ||              || |||  |    *  *                       * |**||* | * |                              |         |  *               ||                             |   |            ||  |                  ||  |                         
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhh..hhhhhhhhhhhh.
sequence :  ..AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDRASKRKTSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
seq num:  ..33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       281       291       301       311       321       331       341       351     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                               | | || |   | ||  |                      | |   |    |  |  |     |            |  ||     |  |               |   |     |||||| |     |  |  |    ||| ||  |                        |  || |  |**^* |             |  | | |          | || | |  |  ||               | || |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                               | | |^**   | ||  |                      | |   |    |  |  |     |            |  ||     |  |               |   |     |||||| |     |  |  |    ^** ||  |                        |  || |  ^** ^**             |  | | |          | || | |  |  ||               | || |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                               | | ||     | ||  |                      | |   |    |  ^***     |            |  ||     |  |               |   |     |||||| |     |  |  |     |  ||  |                        |  || |                      |  | | |          | || | |  |  ||               | || |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                               | | ||     | ||  |                      | |   ^*****           |            |  ||     |  |               |   |     |||||| |     |  |  |     |  ||  |                        |  || |                      ^***** |          | || | |  |  ||               | || |            
search RasMol script viewer Motif-ligand binding stats  G_PROTEIN_RECEP_F1_1 ..                               | | ||     | ||  |                      | |                    *****************|     |  |               |   |     |||||| |     |  |  |     |  ||  |                        |  || |                         |   |          | || | |  |  ||               | || |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                               | | ||     | ||  |                      | |                                 |   |     |  |               |   |     |||||| |     |  |  |     |  ||  |                        |  || |                         |   |          | || | |  *****               | || |            
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                               | | ||     | ||  |                      | |                                 |   |     |  |               |   |     |||||| |     |  |  |     *****  |                        |  || |                         |   |          | || | |  |  |                | || |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..                               | | ||     | ||  |                      | |                                 |   |     |  |               |   |     |||||| |     |  |  |        |   |                        |  || |                         |   |          | || ***  |  |                | || |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                               | | ||     ****  |                      | |                                 |   |     |  |               |   |     |||||| |     |  ****        |   |                        |  || |                         |   |          **** |    ****                **** |            
search RasMol script viewer Motif-ligand binding stats  nest ..                               | | ||       |   |                      ***                                 |   |     |  |               |   |     ****|| |     |  |  |        |   |                        |  |***                         |   |            |  |                          |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..                               | ****       |   |                                                          |   |     ****               |   |      *******     *******        |   |                        ****                            |   |            ****                          ****            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****        *****                                                          *****                        *****                                 *****                                                        *****                                                          

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BETA-1 ADRENERGIC RECEPTOR
member of: CATH:search1.20.1070.10GENE3D:searchG3DSA_1.20.1070.10PANTHER:searchPTHR24248/searchPTHR24248_SF54PFAM:searchPF00001PRINTS:searchADRENERGICR/searchADRENRGCB1AR/searchGPCRRHODOPSNPROSITE PATTERNS:searchPS00237, PROSITE PROFILES:searchPS50262, SUPERFAMILY:searchSSF81321UniProt:searchP07700
JMol viewer RasMol script viewer  2CV 505B  ..                                                                                                                                                        *                                                    ..2CV ..                                                                                 
JMol viewer RasMol script viewer  2CV 503B  ..                                                                                                                            *                           |                                                    ..2CV ..                                                                                 
JMol viewer RasMol script viewer  2CV 501B  ..                                                                                                                            |  *   *                    |                                                    ..2CV ..                                                                                 
JMol viewer RasMol script viewer  Y01 401B  ..                                                                                                                            |  |   |                    |                    *  **                           ..Y01 ..                                                                                 
JMol viewer RasMol script viewer  Y00 601A  ..                                                                                    *   *                                   |  |   |                    |               *    |  ||*                          ..Y00 ..                            **  *               *  **  *                         
JMol viewer RasMol script viewer  2CV 505A  ..                                                                                    |   |                                   | **  *|                    |               |    |  |||                          ..2CV ..                            ||  |               |  ||  |                         
JMol viewer RasMol script viewer  2CV 504A  ..                  *                                                                 |   |                                   | ||  ||                    |               |    |  |||                          ..2CV ..                            ||  |               *  ||  |    *                    
JMol viewer RasMol script viewer  2CV 503A  ..                  |                                                                 |   |                                   | ||  ||                    |               |   *|  |||                          ..2CV ..                            ||  |   **          |  ||  |    |                    
JMol viewer RasMol script viewer  2CV 502A  ..                  |                                                                 |   |                                   | ||  ||                    |               |   ||  |||                          ..2CV ..           *                ||  |   ||          |  ||  |    |                    
JMol viewer RasMol script viewer  2CV 501A  ..                  |                                                                 |   |                                   | ||  ||               ** **|               |  *||* |*|                          ..2CV ..           |                ||  |   ||          |  ||  |    |                    
JMol viewer RasMol script viewer  Y01 402A  ..                  |               *          *      *                               |  **                                 | ||  || *             || |||               |  |||| |||                          ..Y01 ..           |                ||  |   ||          |  ||  |    |                    
JMol viewer RasMol script viewer  Y01 401A  ..                  |               |          |      |                               |  || |      *  *                       * ||* |* |             || |||               |  |||| |||                          ..Y01 ..           |                ||  |   ||          |  ||  |    |                    
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhh..hhhhhhhhhhhh.
sequence :  ..AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQ... ..SRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
seq num:  ..33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233  ... ..278       288       298       308       318       328       338       348        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                               ||| |||||||| ||  |                      | |   |   ||  |  ||   ||   |        |  ||     |  ||   |          |   |     |||||| |        |  |    ||||||  ||                         ..PS00004..|| ||    |   | |  | | |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                               ||| |^**|||| ||  |                      | |   |   ||  |  ||   ||   |        |  ||     |  ||   |          |   |     |||||| |        |  |    ^**|||  ||                         ..PS00005..** ||    |   | |  | | |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                               ||| |||||||| ||  |                      | |   |   ||  ^***|   ||   |        |  ||     |  ||   |          |   |     |||||| |        |  |     | |||  ||                         ..PS00006..|  ||    |   | |  | | |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                               ||| |||||||| ||  |                      | |   ^*****  |   |   ||   |        |  ||     |  ||   |          |   |     |||||| |        |  |     | |||  ||                         ..PS00008..|  ||    |   | ^***** |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  G_PROTEIN_RECEP_F1_1 ..                               ||| |||||||| ||  |                      | |       |   |   |   |*****************|     |  ||   |          |   |     |||||| |        |  |     | |||  ||                         ..PS00237..|  ||    |   |    |   |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                               ||| |*****|| ||  |                      | |       |   |   |   ||   |        |   |     |  ||   |          |   |     |||||| |        |  |     | |||  ||                         ..alphabetamotif..*****    |   |    |   |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..                               ||| |||||||| ||  |                      | |       |   |   |   ||   |        |   |     |  ||   |          |   |     |||||| |        |  |     ***||  ||                         ..asxturn..|  |     |   |    |   |                |  |                    | || |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                               ||| |*****|****  |                      | |       |   |   |   ||   |        |   |     |  ||   |          |   |     |||||| |        |  |        ||  ||                         ..betaturn..****     |   |    |   |                |  |                    **** |            
search RasMol script viewer Motif-ligand binding stats  nest ..                               ||| || |  |  |   |                      ***       |   |   |   ||   |        |   |     |  ||   |          |   |     ****|| |        |  |        ||  ||                         ..nest..         |   |    |   |                |  |                      |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..                               ||**** ****  |   |                                |   |   |   ||   |        |   |     ****|   |          |   |      *******        ****        ||  ||                         ..niche..         |   |    |   |                ****                      ****            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               ||  ||       |   |                                |   |   |   ||   |        |   |         *****          |   |                                 ||  ||                         ..stmotif..         |   |    |   |                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               ******       *****                                *****   **********        *****                        *****                                 ******                         ..ststaple..         *****    *****                                                          

chain B : BETA-1 ADRENERGIC RECEPTOR
member of: CATH:search1.20.1070.10GENE3D:searchG3DSA_1.20.1070.10PANTHER:searchPTHR24248/searchPTHR24248_SF54PFAM:searchPF00001PRINTS:searchADRENERGICR/searchADRENRGCB1AR/searchGPCRRHODOPSNPROSITE PATTERNS:searchPS00237, PROSITE PROFILES:searchPS50262, SUPERFAMILY:searchSSF81321UniProt:searchP07700
JMol viewer RasMol script viewer  Y00 601B  ..                                                                    **              **  **  *                                                                           *         *                                                                  **  *                  **  *                         
JMol viewer RasMol script viewer  2CV 505B  ..                                                                    ||              ||  ||  |                                  *  *  *   *                              |         |                                                                  ||  |                  ||  |                         
JMol viewer RasMol script viewer  2CV 504B  ..               *                                                    ||              ||  ||  |                                  |  |  |   |                              |         |                                                                  ||  |                  |*  |                         
JMol viewer RasMol script viewer  2CV 503B  ..               |                                                    ||              ||  ||  |                                  |  |  |   |                              |         |                                                                  ||  |                  ||  |                         
JMol viewer RasMol script viewer  2CV 502B  ..               |                                                    ||              ||  ||  |                                  |  |  |   |                              |         |                  **                          *  *   *            ||  |                  ||  |                         
JMol viewer RasMol script viewer  2CV 501B  ..               |                                                    ||              ||  ||  |                                  |  |  |   |     *    *   *               |        *|                  ||                          |  |   |            ||  |                  ||  |                         
JMol viewer RasMol script viewer  Y01 402B  ..               |                             *      *               ||              || *||  |                                 ***  *   |     |    |   |               |        ||                  ||                          |  |   |            ||  |                  ||  |                         
JMol viewer RasMol script viewer  Y01 401B  ..               |                             |      |               ||              || |||  |    *  *                       * |**||* | * |     |    |   |               |        ||  *               ||                          |  |   |            ||  |                  ||  |                         
JMol viewer RasMol script viewer  2CV 505A  ..               |                             |      |               ||              || |||  |    |  |                       | |||||| | | |     |    |   |               |        ||  |               ||                          |  |   |            ||  |                  ||  |                         
JMol viewer RasMol script viewer  2CV 503A  ..               |                             |      |               ||              || |||  |    |  |   *              *    * |||||| | | |     |    |   |               |        ||  |               ||                          |  |   |            ||  |                  ||  |                         
JMol viewer RasMol script viewer  2CV 501A  ..               |                             |      |               ||              || |||  |    |  |   |              |    | |*|||* | | |     |    |   |               |        ||  |               ||                          |  |   |            ||  |                  ||  |                         
JMol viewer RasMol script viewer  Y01 401A  ..               |                             |      |               ||              || |||  |    |  |   |              |    | |||||| | | |     |    |   |               |   **  **|  |               ||                          |  |   |            ||  |                  ||  |                         
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhh..hhhhhhhhhhhh.
sequence :  ..AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDRASKRKTSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
seq num:  ..33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       281       291       301       311       321       331       341       351     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                               | | || |   | ||  |                      | |   |    |  |  |     |            |  ||     |  |               |   |     |||||| |     |  |  |    ||| ||  |                        |  || |  |**^* |             |  | | |          | || | |  |  ||               | || |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                               | | |^**   | ||  |                      | |   |    |  |  |     |            |  ||     |  |               |   |     |||||| |     |  |  |    ^** ||  |                        |  || |  ^** ^**             |  | | |          | || | |  |  ||               | || |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                               | | ||     | ||  |                      | |   |    |  ^***     |            |  ||     |  |               |   |     |||||| |     |  |  |     |  ||  |                        |  || |                      |  | | |          | || | |  |  ||               | || |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                               | | ||     | ||  |                      | |   ^*****           |            |  ||     |  |               |   |     |||||| |     |  |  |     |  ||  |                        |  || |                      ^***** |          | || | |  |  ||               | || |            
search RasMol script viewer Motif-ligand binding stats  G_PROTEIN_RECEP_F1_1 ..                               | | ||     | ||  |                      | |                    *****************|     |  |               |   |     |||||| |     |  |  |     |  ||  |                        |  || |                         |   |          | || | |  |  ||               | || |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                               | | ||     | ||  |                      | |                                 |   |     |  |               |   |     |||||| |     |  |  |     |  ||  |                        |  || |                         |   |          | || | |  *****               | || |            
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                               | | ||     | ||  |                      | |                                 |   |     |  |               |   |     |||||| |     |  |  |     *****  |                        |  || |                         |   |          | || | |  |  |                | || |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..                               | | ||     | ||  |                      | |                                 |   |     |  |               |   |     |||||| |     |  |  |        |   |                        |  || |                         |   |          | || ***  |  |                | || |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                               | | ||     ****  |                      | |                                 |   |     |  |               |   |     |||||| |     |  ****        |   |                        |  || |                         |   |          **** |    ****                **** |            
search RasMol script viewer Motif-ligand binding stats  nest ..                               | | ||       |   |                      ***                                 |   |     |  |               |   |     ****|| |     |  |  |        |   |                        |  |***                         |   |            |  |                          |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..                               | ****       |   |                                                          |   |     ****               |   |      *******     *******        |   |                        ****                            |   |            ****                          ****            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****        *****                                                          *****                        *****                                 *****                                                        *****                                                          

   New search    2y01:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors