triangle PDBeMotif: 2xri  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification hydrolase    | release date: Wed, Sep 15, 2010
Title crystal structure of human eri1 exoribonuclease 3
Authors A.FLORES, A.G.THORSELL, A.M.EDWARDS, C.BOUNTRA, C.H.ARROWSMITH, C.PERSSON, E.KOUZNETSOVA, E.WAHLBERG, H.BERGLUND, H.SCHULER, I.JO, J.WEIGELT, L.TRESAUGUES, M.HAMMARSTROM, M.I.SIPONEN, M.MOCHE, M.WELIN, P.NORDLUND, P.SCHUTZ, R.CO, S.FLODIN, S.GRASLUND, S.KOL, S.VAN DER BERG, STRUCTURAL GENOMICS CONSORTIUM, T.KARLBERG, T.KOTENYOVA, T.NYMAN
Method X-RAY DIFFRACTION (resolution: 2.15Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MHHHHHHSSGVDLGTENLYFQSMSFPPQRYHYFLVLDFEATCDKPQIHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVH
PQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWI
NLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKPF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ERI1 EXORIBONUCLEASE 3
JMol viewer RasMol script viewer  GOL 1338A  ..                      ** *  ..    *                                       **                                                                                                                                    
JMol viewer RasMol script viewer  MG 1337A  ..                    * *| |  ..    |                                       ||                                                                                                           *                        
sec str:  ..hhhhh..........eeeee..ee............eeeeeeeeee.....eeeeeeee.........hhhhhhhhh.hhhhhh...hhhhhhhhhhhhhhhh........eeeee..hhhhhhhhhhhhhhhh...hhhhh.eeehhhhhhhhhh.....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhh..........
sequence :  ..NLYFQSMSFPPQRYHYFLVLDFEATCDK..QIHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWINLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKP
seq num:  ..130       140       150     ..159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329     
search RasMol script viewer Motif-ligand binding stats  PS00005 .. |  |  |                    ..                  | |             | |    |   ||||  ||  |             || |||||  |     |  |             |||   ||  |           | |            | |    |  || |  |        || |||   |^** 
search RasMol script viewer Motif-ligand binding stats  PS00006 .. |  |  |                    ..                  | |             | |    |   ||||  ||  |             || |||||  |     ^***             |||   ||  |           | |            | |    |  ^***  |        || |||   | |  
search RasMol script viewer Motif-ligand binding stats  PS00008 .. |  |  |                    ..                  | |             | |    |   |^*****|  |             || |||||  |                      |^*****|  |           | |            | |    |  |^*****        || |||   | |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****  |                    ..                  | |             | |    |   | |****|  |             |****|||  |                      | |    |  |           | |            | |    |  |              |****|   | |  
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |                    ..                  ***             | |    |   ***    |  |             |  ****|  |                      ***    |  |           ***            ***    |  |              |  ***   | |  
search RasMol script viewer Motif-ligand binding stats  niche ..    ****                    ..                  | |             ***    |   | |    ****             |   *******                             ****                                 ****              |    |   ***  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                            ..                  | |                    |   | |                     ******                                                                                         ******        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            ..                  | |                    ***** |                                                                                                                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ..                  ***                        ***                                                                                                                                  

   New search    2xri:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors