triangle PDBeMotif: 2xky  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification metal transport    | release date: Thu, Jul 15, 2010
Title single particle analysis of kir2.1nc_4 in negative stain
Authors J.G.GROSSMANN, L.O'RYAN, M.GOLOVANOVA, M.L.LE, O.K.SLEATOR, R.F.COLLINS, S.FOMINA, S.M.PRINCE, T.D.HOWARD
Method ELECTRON MICROSCOPY; SOLUTION SCATTERING (resolution: 17.20Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains I,J,K,L sequence:
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRGGRNETLVFSHNA
VIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPL
YDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSAR
DLAEKKYILSNANSFCYENEVALTSKEEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPRPLRRESEI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain I : INWARD RECTIFIER POTASSIUM CHANNEL 2
member of: GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF43PFAM:searchPF01007/searchPF08466PIRSF:searchPIRSF005465PRINTS:searchKIR21CHANNEL/searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchP35561
sec str:  .......................................................................................................................................................................................................................................................................................................................
sequence :  ..MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRGGRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPRPLRRESEI
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || ||||    |  | |    |       |    |                            |    |^***                                         |  |  ||             |  |                       |  |             |    |                                                   | ||     |                | ||       |    |  |                    | ||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. || ||||    |  | |    |       |    |                            |    |                                             |  |  ||             |  |                       |  |             |    |                                                   | ||     |                | ||       |    |  |                    **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |^**^**    |  | |    |       |    |                            |    |                                             |  |  ||             |  |                       |  |             |    |                                                   ^**|     |                ^**|       |    |  |                          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |     ^*** |    |       |    |                            |    |                                             |  ^***|             ^***                       ^***             |    |                                                   ^***     |                ^***       |    ^***                          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |    |          |    |       |    |                            |    |                                             *******^                                                         |    |                                                     *******^                           |    |                             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****          ^*****       ^*****                            ^*****                                                                                                              ^*****                                                                                        ^*****                             

chain J : INWARD RECTIFIER POTASSIUM CHANNEL 2
member of: GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF43PFAM:searchPF01007/searchPF08466PIRSF:searchPIRSF005465PRINTS:searchKIR21CHANNEL/searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchP35561
sec str:  .......................................................................................................................................................................................................................................................................................................................
sequence :  ..MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRGGRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPRPLRRESEI
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || ||||    |  | |    |       |    |                            |    |^***                                         |  |  ||             |  |                       |  |             |    |                                                   | ||     |                | ||       |    |  |                    | ||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. || ||||    |  | |    |       |    |                            |    |                                             |  |  ||             |  |                       |  |             |    |                                                   | ||     |                | ||       |    |  |                    **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |^**^**    |  | |    |       |    |                            |    |                                             |  |  ||             |  |                       |  |             |    |                                                   ^**|     |                ^**|       |    |  |                          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |     ^*** |    |       |    |                            |    |                                             |  ^***|             ^***                       ^***             |    |                                                   ^***     |                ^***       |    ^***                          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |    |          |    |       |    |                            |    |                                             *******^                                                         |    |                                                     *******^                           |    |                             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****          ^*****       ^*****                            ^*****                                                                                                              ^*****                                                                                        ^*****                             

chain K : INWARD RECTIFIER POTASSIUM CHANNEL 2
member of: GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF43PFAM:searchPF01007/searchPF08466PIRSF:searchPIRSF005465PRINTS:searchKIR21CHANNEL/searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchP35561
sec str:  .......................................................................................................................................................................................................................................................................................................................
sequence :  ..MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRGGRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPRPLRRESEI
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || ||||    |  | |    |       |    |                            |    |^***                                         |  |  ||             |  |                       |  |             |    |                                                   | ||     |                | ||       |    |  |                    | ||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. || ||||    |  | |    |       |    |                            |    |                                             |  |  ||             |  |                       |  |             |    |                                                   | ||     |                | ||       |    |  |                    **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |^**^**    |  | |    |       |    |                            |    |                                             |  |  ||             |  |                       |  |             |    |                                                   ^**|     |                ^**|       |    |  |                          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |     ^*** |    |       |    |                            |    |                                             |  ^***|             ^***                       ^***             |    |                                                   ^***     |                ^***       |    ^***                          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |    |          |    |       |    |                            |    |                                             *******^                                                         |    |                                                     *******^                           |    |                             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****          ^*****       ^*****                            ^*****                                                                                                              ^*****                                                                                        ^*****                             

chain L : INWARD RECTIFIER POTASSIUM CHANNEL 2
member of: GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF43PFAM:searchPF01007/searchPF08466PIRSF:searchPIRSF005465PRINTS:searchKIR21CHANNEL/searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchP35561
sec str:  .......................................................................................................................................................................................................................................................................................................................
sequence :  ..MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRGGRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPRPLRRESEI
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || ||||    |  | |    |       |    |                            |    |^***                                         |  |  ||             |  |                       |  |             |    |                                                   | ||     |                | ||       |    |  |                    | ||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. || ||||    |  | |    |       |    |                            |    |                                             |  |  ||             |  |                       |  |             |    |                                                   | ||     |                | ||       |    |  |                    **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |^**^**    |  | |    |       |    |                            |    |                                             |  |  ||             |  |                       |  |             |    |                                                   ^**|     |                ^**|       |    |  |                          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |     ^*** |    |       |    |                            |    |                                             |  ^***|             ^***                       ^***             |    |                                                   ^***     |                ^***       |    ^***                          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |    |          |    |       |    |                            |    |                                             *******^                                                         |    |                                                     *******^                           |    |                             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****          ^*****       ^*****                            ^*****                                                                                                              ^*****                                                                                        ^*****                             

   New search    2xky:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML