triangle PDBeMotif: 2xk3  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.11.1
Classification transferase    | release date: Wed, Jul 7, 2010
Title structure of nek2 bound to aminopyrazine compound 35
Authors C.MAS-DROUX, R.BAYLISS
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search XK3 XK3 binding statistics XK3   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT
TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF
GLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SERINE/THREONINE-PROTEIN KINASE NEK2
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24362PFAM:searchPF00069PROSITE PATTERNS:searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP51955
JMol viewer RasMol script viewer  CL 1282A  ..              ..                                                                                    * *                        ..                      ..              ..CL ..                                                                                      
JMol viewer RasMol script viewer  CL 1281A  ..              ..                                                                                    | |                        ..                      ..              ..CL ..                                         *                                            
JMol viewer RasMol script viewer  XK3 1280A  ..           *  .. *            * *                                *               ***** **           | |                        ..        *          ** ..              ..XK3 ..                                         |                                            
sec str:  ...hhh.eeeeeeee....eeeeee.....eeeeeeee.hhhhhhhhhhhhhhhhhhhhh.......eeeeeee....eeeeeee....eehhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee....................... ..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.........hhhhhhhhhhhh..hhhhh.hhhhhhh....hhhhh...
sequence :  ..SRAEDYEVLYTIGT..RCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRS..RDLKPANVFLDGKQNVKLGDFG..VGTPYYMSPEQMNR... ..NEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
seq num:  ..3         13  ..21        31        41        51        61        71        81        91        101       111       121        ..140       150         ..177       187 ... ..194       204       214       224       234       244       254       264       274   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| || |        ..     | ||| |        | ||||  ||   |    |  | |  |        |  ^***      | ||   |   |   | ||         |   |          .. | || || || | |       ..  ||  |       ..PS00001.. | |   |         | |      | ||    | |||    |  |    |   ||  | || || |  ||  | || |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| || |        ..     **^*| |        | ||||  ||   |    |  | |  |        |  |||       | ||   |   |   | ||         |   |          .. | || || || | |       ..  ||  |       ..PS00004.. | |   |         | |      | ||    | |||    |  |    |   ||  | || || |  ||  | || |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || |        ..         | |        | ||||  ||   |    |  | |  |        |  |||       | ||   |   |   | ||         |   |          .. | || || || | |       ..  ||  |       ..PS00005.. | |   |         | |      ^**|    | |||    |  |    |   ||  | || || |  ||  | || |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^*** |        ..         | |        | ^***  ||   |    |  | |  |        |  |||       | ||   |   |   | ||         |   |          .. | || || || | |       ..  ||  |       ..PS00006..** |   |         | |      ^***    | |||    |  |    |   ||  | || || ^***|  | || |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |        ..         | |        |  ||   ||   |    |  | |  |        |  |||       | ||   |   *******^         |   |          .. | || || || | |       ..  ||  |       ..PS00007..   |   |         | |              | |||    |  |    |   ||  | || ||     |  | || |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |        ..         | |        |  ||   ||   |    |  | |  |        |  |||       | ^*****       | |          |   |          .. | || || || | |       ..  ||  |       ..PS00008..   |   |         | |              | |||    |  |    |   ||  | || ||     |  | || |  |   
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..  |  |        ..         | |        |  ||   ||   |    |  | |  |        |  |||       |  |           | |          |   |          ..*^********| | |       ..  ||  |       ..PS00108..   |   |         | |              | |||    |  |    |   ||  | || ||     |  | || |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |        ..         | |        |  ||   ||   |    |  | |  |        |  |||       |  |           | |          |   |          .. | || ||  | | |       ..  ||  |       ..alphabetamotif..   |   |         | |              | |||    |  |    |   ||  | *****     |  | || |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |        ..         | |        |  ||   ||   |    |  | |  |        *****|       |  |           | |          |   |          .. | || ||  | | |       ..  ||  |       ..asxmotif..   |   |         | |              | |||    |  |    |   ||  | || ||     |  | || |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |        ..         | |        |  ||   ||   |    |  | |  |           | |       |  |           | |          |   |          .. | || ||  *** |       ..  ||  |       ..asxturn..   |   |         | |              | |||    |  |    |   ||  ***| ||     |  ***| |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |        ..         | |        ****|   ||   |    |  | |  |           | |       ****           | |          |   |          .. | ****|    | |       ..  ||  |       ..betaturn..   |   |         | |              ****|    |  |    |   ||  | ****|     |  |  | |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |        ..         ***        |  ||   ||   |    |  | |  |           ***                      ***          |   |          .. | || ||    ***       ..  ||  |       ..nest..   |   |         ***                ***    |  |    |   ||  | ||  |     |  |  | |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..  ****        ..                    ****|   ||   |    **** ****                                                 |   |          .. | |****              ..  |****       ..niche..   |   |                                   ****    |   |**********     ******* ****   
search RasMol script viewer Motif-ligand binding stats  stmotif ..              ..                        *****|   |                                                              |   |          .. | |  |               ..  |           ..stmotif..   |   |                                           |   |                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..              ..                             *****                                                              *****          .. | |  |               ..  |           ..ststaple..   *****                                           *****                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..              ..                                                                                                               .. * *  *               ..  *           ..REP00000..                                                                                      

   New search    2xk3:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors