triangle PDBeMotif: 2xcw  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.3.5
Classification hydrolase    | release date: Mon, Apr 26, 2010
Title crystal structure of the d52n variant of cytosolic 5'-nucleo in complex with inosine monophosphate and atp
Authors K.WALLDEN, P.NORDLUND
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search IMP IMP binding statistics IMP   search ATP ATP binding statistics ATP   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYKS
PEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFI
QRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENL
EKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVL
RQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVW
TDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYA
ASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOSOLIC PURINE 5'-NUCLEOTIDASE
member of: GENE3D:searchG3DSA_3.40.50.1000PANTHER:searchPTHR12103/searchPTHR12103_SF17PFAM:searchPF05761PIRSF:searchPIRSF017434SUPERFAMILY:searchSSF56784TIGRFAMS:searchTIGR02244UniProt:searchP49902
JMol viewer RasMol script viewer  MG 1498A  ..                                                 * *                                                                                                                                                                                                                                                                                                        *                                                 ..MG ..                                                                        
JMol viewer RasMol script viewer  MG 1497A  ..                                                 | |                                                                                                                                                                                                                                                                                                        |                                                 ..MG ..                                                                        
JMol viewer RasMol script viewer  GOL 1496A  ..                                                 | |                                                                                                                                                                                                     **                                  **                    * *                                      |                                                 ..GOL ..                                                                        
JMol viewer RasMol script viewer  GOL 1495A  ..                                                 | |                                                                                                ****   *                                                                                             ||                                  ||                    | |                                      |*                                                ..GOL ..                                                                        
JMol viewer RasMol script viewer  GOL 1494A  ..                                                 | |                                                                                                ||||   |                                                                                             ||   *   *                ***       ||                    | |                                      ||                                                ..GOL ..                                                                        
JMol viewer RasMol script viewer  GOL 1493A  ..                                                 | |                                          *                                                     ||||   |                                                                                             ||   |   |                |||       ||                    | |                                      ||                     *   *                      ..GOL ..                 *                                                      
JMol viewer RasMol script viewer  GOL 1492A  ..                                                 | |                                          |                                                     *|||   |                                       **  *                                                 ||   |   |                |||       ||                    | |                                      ||                     |   |                      ..GOL ..                 |                                                      
JMol viewer RasMol script viewer  GOL 1491A  ..                                                 | |                                          |                                                     ||||   |                                       ||  |                                                 ||   |   |                |||  ** * ||                    | |        *****                         ||                     |   |                      ..GOL ..                 |                                                      
JMol viewer RasMol script viewer  IMP 1490A  ..                                                 ***                                          |                                                     ||||  *|                                       ||  *   *  **    *                                 ***||   |   |                |||  || | ||  *                 | |        |||||                         ||                     |   |                      ..IMP ..                 |                                                      
JMol viewer RasMol script viewer  ATP 1489A  ..                                                 |||                                          |                                              ** *   |*|*  ||                                       ||  |   |  ||    |                                 |||||   |   |                |||  || | ||  |                 | |        |||||                         || *       *           |   |                      ..ATP ..                 |                  *  **                               
sec str:  ...hhhhhhhhhhh.....hhhhhhhhhhhhhhh.ee...ee.hhh.eeee...........hhhhhhhhhhhhhhhhhh..hhhhhhh...........eee....eeeee.....eeeeee..ee.hhhhhhhhh............eee..hhhhhhhhhhhhhhhhhhhhh...eee..eeee..eeeehhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh....hhhhhhhhhhhhheeeee...hhhhhhhhhhhhh.............hhhhhh.eeee....hhhhh....eee......................eee.hhhhhhhhhh.hhh.eeeee.....hhhhhhhhhh.eeeee..hhhhhhhhhhhhhhhhhhhhhhhhhh.... ..hhhhhhhhhhhhhhhhh........ee..eehhhhhhhhhhh.eee.hhhhhhhh....ee......hhhhh
sequence :  ..TSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLA... ..SSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHES
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393     ... ..417       427       437       447       457       467       477         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |||   |  |  | |   |  |  || ||   ^*** |  |        ||||                  || |||  || ||  | |  |  |  | || |    | | | ||   | |          | |||  |  | |||   | |||  |         |  |  ||  |          | | |    |       |  |||| |    |  |  | |                 | ||   |||  || |||    |  || |  || ||    |||||| ||        | || |          | ||   |||  || | | |||  | | | |   |   | | | |                | | |  |          ..PS00001..      || ||       |  ||||  | | ||  |  |  |     | | || ||  |        |  ||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |||   |  |  | |   |  |  || ||        |  |        ||||                  || |||  || ||  | |  |  |  | || |    | | | ||   | |          | |||  |  | |||   | |||  |         |  |  ||  |          | | |    |       |  |||| |    |  |  | |                 | ||   |||  || |||    |  || |  || ||    |||||| ||        | || |          | ||   |||  || | | |||  | | | |   |   | | | |                | | |  |          ..PS00004..      |**^*       |  ||||  | | ||  |  |  |     | | || ||  |        |  ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ^**   |  |  | |   |  |  || ||        |  |        ||||                  || |||  || ||  | |  |  |  | || |    | | | ||   | |          | |||  |  ^**||   | |||  |         |  |  ||  |          ^** |    |       |  ^**| |    |  |  | |                 | ||   ^**  || |||    |  |^**  || ||    |||||| ||        | |^**          | ||   |||  || | | |||  | | | |   |   ^** | |                ^** |  |          ..PS00005..      |   |       |  ||||  | | ||  |  |  |     | | || ||  |        |  ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***    |  |  | |   |  |  || ||        |  |        ||||                  || |||  || ||  | |  |  |  | || |    | | | ||   | |          | |||  |  |  ||   | |||  |         |  |  |^***          |   |    |       |  ^*** |    |  |  | |                 ^***   ||   || |||    |  |     |^***    |||||| ||        | || |          | ||   |||  ^*** | |||  | | | |   |   |   | |                    ^***          ..PS00006..      |   |       |  ||||  | | ||  |  |  |     | | || ||  |        |  |^
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |     |  |  | |   |  |  || ||        |  |        ||||                  || |||  || ||  | |  |  |  | || |    | | | ||   | |          | |||  *******^   | |||  |         |  |  |              |   |    ********^   |   |    |  |  | |                 | ||   ||   || |||    |  |     |  |     |||||| ||        | || |          | ||   |||  ||   | |******^ | |   |   |   | |                                  ..PS00007..      |   |       |  ||||  | | ||  |  |  |     | | || ||  |        |  ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..** |     |  |  | |   |  |  || ||        |  |        ||||                  || |||  || ||  | |  |  |  | || |    | | | ||   | |          | |||     |  |    | |||  |         |  |  |              |   |                |   |    |  |  | |                 | ||   ||   || |||    |  |     |  |     |||||| ||        | || |          | ^*****^*****   | | |  |   | |   |   |   | |                                  ..PS00008..      |   |       ^*****|  ^*****  |  |  |     | | || ||  |        |  ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |     |  |  | |   |  |  *****        |  |        ||||                  || |||  || ||  | |  |  |  | || |    | | | ||   | |          | |||     |  |    | |||  |         |  |  |              |   |                |   |    |  |  | |                 | ||   ||   || |||    |  |     |  |     |||||| ||        | || |          |  |     |  |    | | |  |   | |   |   |   | |                                  ..alphabetamotif..      |   |       |  || |  | | |   |  |  |     | | || ||  |        |  ||
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |     |  |  | *****  |  || ||        |  |        ||||                  || |||  || ||  | |  |  |  | || |    | | | ||   | |          | |||     |  |    | |||  |         |  |  |              |   |                |   |    |  |  | |                 | ||   ||   || |||    |  |     |  |     |||||| ||        | || |          |  |     |  |    | | |  |   | |   |   |   | |                                  ..asxmotif..      |   |       |  || |  | | |   |  |  |     | | || ||  |        |  ||
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |     |  |  | |      |  || ||        |  |        ||||                  || |||  || ||  ***  |  |  ***| |    *** | ||   | |          | |||     |  |    | |||  |         |  |  |              |   |                |   |    |  |  ***                 | ||   ||   || |||    |  |     |  |     |||||| ||        ***| |          |  |     |  |    | | |  |   | |   |   |   | |                                  ..asxturn..      |   |       |  || |  | | |   |  |  |     | | || ||  |        |  ||
search RasMol script viewer Motif-ligand binding stats  betabulge .. | |     |  |  | |      |  || ||        |  |        ||||                  || |||  || ||       |  |     | |      | | **   | |          | |||     |  |    | |||  |         |  |  |              |   |                |   |    |  |                      | ||   ||   || |||    |  |     |  |     |||||| ||        |  | |          |  |     |  |    | | |  |   | |   |   |   | |                                  ..betabulge..      |   |       |  || |  | | |   |  |  |     | | || ||  |        |  ||
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. | |     |  |  | |      |  || ||        |  |        ||||                  || |||  || ||       |  |     | |      | |      | |          | |||     |  |    | |||  |         |  |  |              |   |                |   |    |  |                      | ||   ||   || |||    |  |     |  |     |||||| ||        ******          |  |     |  |    | | |  |   | |   |   |   | |                                  ..betabulgeloop..      |   |       |  || |  | | |   |  |  |     | | || ||  |        |  ||
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |     |  |  | |      |  ****|        |  |        ||||                  |****|  *****       |  |     | |      | |      | |          ****|     |  |    ****|  |         |  |  |              |   |                |   |    |  |                      | ||   ||   |****|    ****     |  |     ||||*****           | |          |  |     ****    | | |  |   | |   |   |   | |                                  ..betaturn..      |   |       ****| |  | | |   |  |  |     | **** ||  |        ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |     |  |  | |      |  ||  |        |  |        ||||                  |  | |   |  |       |  |     | |      | |      | |            | |     |  |    | |||  |         |  |  |              |   |                |   |    |  |                      | ||   ||   |  ***    |  |     |  |     ||||                | |          |  |             | | |  |   | |   |   |   | |                                  ..gammaturn..      |   |           | |  | | |   |  |  |     | | |  ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  nest .. | |     |  |  | |      |  ||  |        |  |        ***|                  |  ***   |  |       |  |     ***      ***      | |            ***     |  |    | |||  |         |  |  |              |   |                |   |    |  |                      | ||   ||   |         |  |     |  |     ****                ***          |  |             *** |  |   | |   |   |   ***                                  ..nest..      |   |           | |  | | |   |  |  |     | | |  ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  niche .. | |     ****  ***      ********        ****         ***                  |    |   ****       ****                       ***                    ****    | |||  |         *******              |   |                |   |    ****                      ***|   ||   |         ****     ****                         | |          ****                 ****   ***   |   |                                        ..niche..      |   |           | |  *** |   |  ****     | | ********        |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop .. | |                                                                      ******                                                                        | |||  |                              |   |                |   |                              | ||   ||   |                                               | |                                            |   |                                        ..schellmannloop..      |   |           | |      |   |           | |                 |   |
search RasMol script viewer Motif-ligand binding stats  stmotif .. | |                                                                                                                                                    *****  |                              *****                |   |                              | ||   ||   |                                               | |                                            |   |                                        ..stmotif..      |   |           | |      *****           | |                 |   |
search RasMol script viewer Motif-ligand binding stats  ststaple .. | |                                                                                                                                                    | |*****                                                   *****                              | |**********                                               | |                                            *****                                        ..ststaple..      *****           | |                      | |                 *****
search RasMol script viewer Motif-ligand binding stats  stturn .. ***                                                                                                                                                    ***                                                                                           ***                                                         ***                                                                                         ..stturn..                      ***                      ***                      

   New search    2xcw:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors