triangle PDBeMotif: 2x7n  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification ribosomal protein/rna    | release date: Tue, Mar 2, 2010
Title mechanism of eif6s anti-association activity
Authors J.-P.ARMACHE, M.BLAU, M.GARTMANN, M.TOPF, R.BECKMANN, T.MIELKE
Method ELECTRON MICROSCOPY (resolution: 11.80Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain B sequence:
MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQE
LQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPDIDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGL
VHPQTSVQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRL
Chain C sequence:
AQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSW
RRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV
Chain D sequence:
MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : EUKARYOTIC TRANSLATION INITIATION FACTOR 6
member of: GENE3D:searchG3DSA_3.75.10.10HAMAP:searchMF_00032PANTHER:searchPTHR10784/searchPTHR10784_SF0PFAM:searchPF01912PIRSF:searchPIRSF006413SMART:searchSM00654SUPERFAMILY:searchSSF55909TIGRFAMS:searchTIGR00323UniProt:searchQ12522
sec str:  ...eeee......hhhhheee....eeee...hhhhhhhhhhhhh....eeee......hhhhhhee...eeeee...hhhhhhhhhhhh....eeeee.....hhhhheee...eeee....hhhhhhhhhhhhh.eeee.......hhhh.eee....eee....hhhhhhhhhhhhh..eee........hhhhheee....eeee...hhhhhhhhhhhh..
sequence :  ..MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPDIDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  | |  ||  |           |  | ||| ||  |  |              |  | ||  ||  |  ||  || | | ||||^**         | |||| || ||   |  ||   |      | |           | |||| || |    |  ||  |||   | | |          | | | ||  ||||  || |||| | |  |  | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** |  ||  |           |  | ||^***  |  |              |  | ||  ||  |  |^***| | | ^*** |          | |||| || ||   |  ||   |      | |           | |||| || |    |  |^***||   | | |          | | | ||  ||||  ^***|^*** ^***  | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |  ||  |           ^*****|| ||  |  |              |  | ^*****  |  ||   | | | |||  |          | ^*****| ||   |  ||   |      | |           | ^*****| |    |  ||   ||   | | |          | | | ^*****||   ^*****         | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |  ||  |              |  *****  |  |              |  |  |  |   |  ||   | | | |||  |          *****|  | ||   |  ||   |      | |           *****|  | |    |  ||   ||   | | |          | | |  |  | ||   |  |           | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |  ||  |              |  || |   |  |              |  |  |  |   |  ||   | | | |||  |          | || |  | ||   |  |*****      | |           | || |  | |    |  ||   ||   | | |          | | |  |  | ||   |  |           | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |  ||  |              |  || |   |  |              |  |  |  |   |  ||   | | | |||  |          | || |  ***|   |  |           | |           | || |  | |    |  ||   ||   | | |          | | |  |  ***|   |  |           | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |  ||  |              |  ****   ****              |  |  |  |   |  ||   | | | |||  |          **** |  |  |   |  |           | |           **** |  | |    |  ||   ||   | | |          | | |  |  |  |   |  |           | |
search RasMol script viewer Motif-ligand binding stats  nest ..       | |  ||  |              |   |                       |  |  |  |   |  ||   | | | |||  |            |  |  |  |   |  |           ***             |  |  | |    |  ||   ||   | ***          | | |  |  |  |   |  |           ***
search RasMol script viewer Motif-ligand binding stats  niche ..       ***  |****              |   |                       ****  ****   ****|   | | ********            ****  ****   ****                           ****  | |    ****|   ||   |              | | ****  ****   ****              
search RasMol script viewer Motif-ligand binding stats  stmotif ..            |   |              |   |                                        ***** |   |                                                                   | |        *****|   |              | |                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****              *****                                              *****                                                                   | |             *****              | |                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                          ***                                ***                                

chain C : 60S RIBOSOMAL PROTEIN L23
member of: GENE3D:searchG3DSA_2.40.150.20HAMAP:searchMF_01367PANTHER:searchPTHR11761PFAM:searchPF00238PROSITE PATTERNS:searchPS00049, SUPERFAMILY:searchSSF50193UniProt:searchP0CX41
sec str:  ........ee...ee...eeee.....eeeeeeeeeee.........ee....eeeeeeeee.......eeeeeeee....ee.....ee.....eeee..............eeehhhhhhhhhhhh...eee
sequence :  ..AQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |    | |  |       | |||         |  | ||   |  |    ^**|  | || |   |  ||| |^**| |||          |       ||||  |          | ||| |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |    | |  |       | |||         |  | ||   ^***      ||  | || |   |  ||| |   | |||          |       ||||  |          | ||| |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |    ^*****       | |||         ^*****|   |  |      ||  | || |   |  ||| |   | |||          |       |^*****          | ||| |    
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L14 ..   | |      |  |       | |||            |  |   |  |      ||  | || |   ***************************       ||||             | ||| |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |      |  |       | |||            |  |   |  |      ||  | || |      ||| |   | ***                  ||||             | ||| |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | |      |  |       | |**            |  |   |  |      **  | || |      **| |   | |||                  ||||             | ||| |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |      |  |       | |              |  |   ****          | ****        | |   ****|                  ||||             | |****    
search RasMol script viewer Motif-ligand binding stats  nest ..   ***      |  |       ***              |  |   |  |          | || |        | |     ***                  ****             | ||| |    
search RasMol script viewer Motif-ligand binding stats  niche ..            ****       | |              ****   ****          ******        ***                                           | |****    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       | |                                                                                               *******    
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ***                                                                                                          

chain D : 60S RIBOSOMAL PROTEIN L24-A
member of: GENE3D:searchG3DSA_2.30.170.20PANTHER:searchPTHR10792/searchPTHR10792_SF1PFAM:searchPF01246PROSITE PATTERNS:searchPS01073, SUPERFAMILY:searchSSF57716UniProt:searchP04449
sec str:  ....................eeee.....eeee.hhhhhhhhhhh.............
sequence :  ..MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFR
seq num:  ..1         11        21        31        41        51    
search RasMol script viewer Motif-ligand binding stats  RGD ..     | || |  |  |     ***||            | ||||| ||  |    
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L24E ..     | ******************||            | ||||| ||  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..     ***| |  |  |     |||||            | ||||| ||  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |  ****     |||||            ****|****|  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        ***           *****              *** |  |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                             *******    

chain A : SARCIN-RICIN LOOP
sec str:  ..............................
sequence :  ..ACCGUAUAGUACGAGAGGAACUACGGUU
seq num:  ..2684      2694      2704    

   New search    2x7n:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML