triangle PDBeMotif: 2x4x  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Tue, Feb 2, 2010
Title molecular basis of histone h3k36me3 recognition by the pwwp domain of brpf1.
Authors A.VEZZOLI, B.GOTTGENS, B.J.P.HUNTLY, B.KVINLAUG, C.M.SANTIVERI, M.BYCROFT, M.D.ALLEN, N.BONADIES, S.M.V.FREUND
Method X-RAY DIFFRACTION (resolution: 1.85Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4
Modified residues:  search M3L M3L binding statistics M3L
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C,E,G sequence:
GGSEDEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRT
WQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE
Chains B,D,F,H sequence:
TKAARKSAPATGGVKKPHRYR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : PEREGRIN
member of: CATH:search2.30.30.160GENE3D:searchG3DSA_2.30.30.160PANTHER:searchPTHR13793/searchPTHR13793_SF85PFAM:searchPF00855PROSITE PROFILES:searchPS50812, SMART:searchSM00293SUPERFAMILY:searchSSF63748UniProt:searchP55201
sec str:  ..........eeee.......eeeeee........eee..eee...hhhhhhhhhhhhhhhh...eeeee......eeeehhh.eee...hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..DSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE
seq num:  ..1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***  |     |  |        |  ||  |  |  |                   | |      | | | |     |  |   | | |     | || |                        
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    |  |     |  |        |  ||  |  |  |                   | |      | | | |     |  |   | | |     | ^***                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |  |     |  |        |  ||  |  |  |                   | |      | | | |     |  |   | ***     |  |                          
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****     ****        |  |****  ****                   | |      | | | |     |  |   | |       |  |                          
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |     |  |        |  |                             ***      | | ***     |  |   ***       |  |                          
search RasMol script viewer Motif-ligand binding stats  niche ..    ****     ****        ****                                      ***         ****             ****                          

chain F : HISTONE H3.2
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR11426PRINTS:searchHISTONEH3SMART:searchSM00428SUPERFAMILY:searchSSF47113UniProt:searchQ71DI3
sec str:  .............
sequence :  ..SAPATGGVKKP
seq num:  ..28         

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : PEREGRIN
member of: CATH:search2.30.30.160GENE3D:searchG3DSA_2.30.30.160PANTHER:searchPTHR13793/searchPTHR13793_SF85PFAM:searchPF00855PROSITE PROFILES:searchPS50812, SMART:searchSM00293SUPERFAMILY:searchSSF63748UniProt:searchP55201
sec str:  ..........eeee.......eeeeee........eee..eee...hhhhhhhhhhhhhhhh..eeeeee......eeeee...eee...hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..DSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQG
seq num:  ..1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***  |     |  |        |  ||  |  |  |            |   |  | |      | | | |     |  |   | |   |   | || |                       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    |  |     |  |        |  ||  |  |  |            |   |  | |      | | | |     |  |   | |   |   | ^***                       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    |  |     |  |        |  ||  |  |  |            |   |  | |      | | | |     |  |   | *****   |  |                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****     |  |        |  |****  ****            |   |  | |      | | | |     |  |   | |       |  |                         
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |     |  |        |  |                      |   |  ***      | | ***     |  |   ***       |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..    ****     ****        ****                      |   |           ***         ****             ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                   *****                                                                     

chain D : HISTONE H3.2
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR11426PRINTS:searchHISTONEH3SMART:searchSM00428SUPERFAMILY:searchSSF47113UniProt:searchQ71DI3
sec str:  ..............
sequence :  ..SAPATGGVKKPH
seq num:  ..28          

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain G : PEREGRIN
member of: CATH:search2.30.30.160GENE3D:searchG3DSA_2.30.30.160PANTHER:searchPTHR13793/searchPTHR13793_SF85PFAM:searchPF00855PROSITE PROFILES:searchPS50812, SMART:searchSM00293SUPERFAMILY:searchSSF63748UniProt:searchP55201
sec str:  ........eeee.......eeeeee.........ee..ee....hhhhhhhhhhhhhhhh..eeeeee......eeeee...eee...hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..PLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQ
seq num:  ..1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***  |     |  |        | |||  |  |  |                   | |      | | | |     |  |   | | |     | || |                      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  |     |  |        | |||  |  |  |                   | |      | | | |     |  |   | | |     | ^***                      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |     |  |        *****  |  |  |                   | |      | | | |     |  |   | | |     |  |                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |     |  |        ***||  |  |  |                   | |      | | | |     |  |   | ***     |  |                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****     |  |        ********  ****                   | |      | | | |     |  |   | |       |  |                        
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |     |  |        |  |                             ***      | | ***     |  |   ***       |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..  ****     ****        ****                                      ***         ****             ****                        

chain H : HISTONE H3.2
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR11426PRINTS:searchHISTONEH3SMART:searchSM00428SUPERFAMILY:searchSSF47113UniProt:searchQ71DI3
sec str:  ..............
sequence :  ..SAPATGGVKKPH
seq num:  ..28          

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEREGRIN
member of: CATH:search2.30.30.160GENE3D:searchG3DSA_2.30.30.160PANTHER:searchPTHR13793/searchPTHR13793_SF85PFAM:searchPF00855PROSITE PROFILES:searchPS50812, SMART:searchSM00293SUPERFAMILY:searchSSF63748UniProt:searchP55201
JMol viewer RasMol script viewer  SO4 2206A  ..                              *              *                                                                                
sec str:  ..........eeee.......eeeeee........eee..eee...hhhhhhhhhhhhhhhh..eeeeee......eeeee...eee...hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..DSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE
seq num:  ..1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***  |     |  |        |  ||  |  |  |                   | |          | |     |  |   | |   |   | || |                     | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    |  |     |  |        |  ||  |  |  |                   | |          | |     |  |   | |   |   | ^***                     | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    |  |     |  |        |  ||  |  |  |                   | |          | |     |  |   | *****   |  | |                     | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  |     |  |        |  |****  ****                   | |          | |     |  |   | |       |  | |                     | |
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |     |  |        |  |                             ***          ***     |  |   ***       |  | |                     ***
search RasMol script viewer Motif-ligand binding stats  niche ..    ****     ****        ****                                                  ****             ******                        

chain B : HISTONE H3.2
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR11426PRINTS:searchHISTONEH3SMART:searchSM00428SUPERFAMILY:searchSSF47113UniProt:searchQ71DI3
sec str:  ................
sequence :  ..SAPATGGVKKPHRY
seq num:  ..28        38  

   New search    2x4x:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors