triangle PDBeMotif: 2wsl  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.1.8
Classification hydrolase    | release date: Tue, Sep 8, 2009
Title aged form of human butyrylcholinesterase inhibited by tabun analogue ta4
Authors E.CARLETTI, E.GILLON, F.NACHON, F.WOREK, H.THIERMANN, J.FONTECIL, M.LOIODICE, N.AURBEK, P.MASSON, Y.NICOLET
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search F F binding statistics F   search FUC FUC binding statistics FUC   search EFS EFS binding statistics EFS   search FUL FUL binding statistics FUL   search SO4 SO4 binding statistics SO4   search NA NA binding statistics NA   search CL CL binding statistics CL
Modified residues:  search CSS CSS binding statistics CSS
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
EDDIIIATKNGKVRGMQLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSE
MWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNP
EAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEAR
NRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVG
VNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFIC
PALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDQYTKAEEILSRSIVKRWANFAKYGNP
QETQNQSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CHOLINESTERASE
member of: CATH:search3.40.50.1820GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF154PFAM:searchPF00135PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP06276
JMol viewer RasMol script viewer  F 1546A  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                               *                                                               
JMol viewer RasMol script viewer  EFS 1544A  ..                                                                                                                 **                                                                                **                               *                                                      *                                                                                                                                                       *                           |                                                               
JMol viewer RasMol script viewer  SO4 1543A  ..                                                                                                                 ||                                                                                ||                               |                                                      |                             *                                                                                                ***                      |                           |                                                               
JMol viewer RasMol script viewer  NA 1542A  ..                                                                                                                 ||                                                                                ||                               |                                                      |                             |                                                                                                |||                      |                           |                                                               
JMol viewer RasMol script viewer  CL 1541A  ..                                                                                                                 ||                                                                                ||                               |                                                      |                             |                                  *                                                             |||                      |                           |                                                               
JMol viewer RasMol script viewer  FUC 1540A  ..                                                                                                                 ||                                                                                ||                               |             *   *                            *       |                             |                                  |                                                             |||                      |                           |                                                               
JMol viewer RasMol script viewer  NAG 1538A  ..                                                                                                                 ||                                                                                ||                               |     *   *   *   |                            |  *    |                             |                                  |                                                             |||                      |                           |                                                               
JMol viewer RasMol script viewer  NAG 1539A  ..                                                                                                                 ||                                                                                ||                               |     |   |   |   |                            |  |    |                             |                                  |                                                             |||                      |                           |                                                               
JMol viewer RasMol script viewer  NAG 1537A  ..                                                                                                                 ||                                                                                ||                               |     |   |   |   |      * *                   |  |    |                             |                                  |                                                             |||                      |                           |                                                               
JMol viewer RasMol script viewer  NAG 1536A  ..                                                                                                                 ||                                                                                ||                               |     |   |   |   |      | |                   |  |    |                             |                                  |                                                             |||                      |                          *|  *               *                                            
JMol viewer RasMol script viewer  NAG 1535A  ..           *                                          *                                                          ||                                                                                ||                               |     |   |   |   |      | |                   |  |    |                             |                                  |                                                             |||                      |                          ||  |               |                                            
JMol viewer RasMol script viewer  FUC 1534A  ..           |                                          |                                                          ||                                                                      * **      ||                               |     |   |   |   |      | |                   |  |    |                             |                                  |                                                             |||                      |                          ||  |               |                                            
JMol viewer RasMol script viewer  NAG 1533A  ..           |                                          |                                                *         ||                                                                      * *|      ||                               |     |   |   |   |      | |                   |  |    |                             |                                  |                                                             |||                      |                          ||  |               |                                            
JMol viewer RasMol script viewer  FUL 1532A  ..           |                                          |                                                |         ||                                                                      | ||      ||                               |     |   |   |   |      | |                   |  |    |                             |                                  |                                                             |||                      |                          ||  |               |                                            
JMol viewer RasMol script viewer  NAG 1530A  ..           |                                          |                                                |         ||                                                                      | ||      ||                               |     |   |   |   |      | |                   |  |    |                             |                     *  *         |                                                             |||                      |                          ||  |               |                                            
JMol viewer RasMol script viewer  NAG 1531A  ..           |                                          |                                                |         ||                                                                      | ||      ||                               |     |   |   |   |      | |                   |  |    |                             |                  ** |  |         |                                                             |||                      |                          ||  |               |                                            
sec str:  ....eeee..eeee.eeeee..eeeeeeeeee.....hhhhh............eee..................hhhhhh............eeeeeee......eeeeeee...........hhhhhhhhhhhhhh.eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhhhhhhhhh.eeeee...........hhhhhhhhhhhhhhhh.....hhhhhhhhhh..hhhhhhhhhhhhh.....................hhhhhhhh.......eeeeee...hhhhhhhh............hhhhhhhhhhhhh...hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeee.........hhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh....................eeeee......eee..hhhhhhhhhhh....
sequence :  ..DIIIATKNGKVRGMQLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDQYTKAEEILSRSIVKRWANFAKYGNPQETQNQSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKV
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | |    |    | ||   || ||   |  || || |            ^***         | ||  |   |  |     |||| |     |     ^***      ||| |||  ||  |       | |           |  | |  | |   | |              || ||||  ||     |||  |   |  |   |  |        |  ||  | |  || ^*** |   ||||| ^***   || ||         |  |  ||  ||      ||||          | |             |        |  || |^*** | ||            |   |   |   |   | |                     |   ||||| | |      | | | ||||    |  ||||    |||  |  | ||  |                | |     ^***     | |   |   | || |     | |            
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     | |    |    | ||   || ||   |  || || |                         | ||  |   |  |     |||| |     |               ||| |||  ||  |       | |           |  | |  | |   | |              || ||||  ||     |||  |   |  |   |  |        |  ||  | |  ||   |  |   ||||| | |    || ||         |  |  ||  ||      ||||          | |             |        |  || ||| | | ||            |   |   |   |   | |                     |   |**^* | |      | | | ||||    |  ||||    |||  |  | ||  |                | |     | |      | |   |   | || |     | |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | |    |    | ||   || ||   |  || || |                         | ||  |   |  |     |||| |     |               ||| |||  ||  |       | |           |  | |  | |   | |              || ||||  ||     |||  |   |  |   |  |        |  ||  | |  ||   |  |   ||||| | |    || ||         |  |  ||  ||      ||||          | |             |        |  || ||| | ^**|            |   |   |   |   | |                     |   ^**   | |      | | ^**|||    |  ||||    |||  |  | ||  |                | |     | |      | |   |   | |^**     | |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |    |    | ||   || ||   |  || || |                         | ||  |   |  |     |||| |     |               ||| |||  ||  |       | |           |  | |  | |   | |              || ||||  ||     |||  |   |  |   |  |        |  ||  | ^***|   |  |   ||||| | |    || ||         |  |  ||  ||      ||||          | |             |        |  || ||| | ^***            |   |   |   |   | |                     |   |     | |      | | | ||||    |  ||||    |||  |  | |^***                | |     | |      | |   |   | |        | |            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     | |    |    | ||   || ||   |  || || |                         | ||  |   |  |     |||| |     |               ||| |||  ||  |       | |           |  | |  | |   | |              || ||||  ||     |||  |   |  |   |  |        |  ||  | |   |   |  |   ||||| | |    || ||         |  |  ||  ||      ||||          | |             |        |  || ||| |                 |   |   |   |   | |                     |   |     | |      | | | ||||    |  ||||    |||  |  | |                    | |     | |      ******^   | |        | |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |    ^***** ^*****| ^*****  || || |                         | ||  |   |  |     |||| |     |               ^*****|  ||  |       | |           |  | |  | |   | |              || ||^*****     |||  |   |  |   |  |        |  ||  | |   |   |  |   ||||| | |    || ||         |  |  ^*****      ||||          | |             |        |  || ||| |                 |   |   |   |   | |                     |   |     | |      | | | ||||    ^*****|    |||  |  | |                    | |     | |      | |       | |        | |            
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 ..     | |         |  |    |  |      || || |                         | ||  |   |  |     |||| |     |               ||| | |  ||  |       | |           |  | |  | |   | |              || *************^**  |   |  |   |  |        |  ||  | |   |   |  |   ||||| | |    || ||         |  |   |  |       ||||          | |             |        |  || ||| |                 |   |   |   |   | |                     |   |     | |      | | | ||||       || |    |||  |  | |                    | |     | |      | |       | |        | |            
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 ..     | |         |  |    |  |      || || |                         | ||  |   |  |     |**^********               ||| | |  ||  |       | |           |  | |  | |   | |              || ||||  |      ||   |   |  |   |  |        |  ||  | |   |   |  |   ||||| | |    || ||         |  |   |  |       ||||          | |             |        |  || ||| |                 |   |   |   |   | |                     |   |     | |      | | | ||||       || |    |||  |  | |                    | |     | |      | |       | |        | |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |         |  |    |  |      || || |                         ***|  |   |  |     | || |                     ||| | |  ||  |       | |           |  | |  ***   | |              || ||||  |      ||   |   |  |   |  |        |  ||  | |   |   |  |   ||||| ***    || ||         |  |   |  |       ***|          | |             |        |  || ||| |                 |   |   |   |   | |                     |   |     | |      | | | ||||       || |    |||  |  | |                    | |     | |      | |       ***        | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |         ****    |  |      ****| |                            ****   |  |     | || |                     ||| | |  ||  |       | |           |  | ****     | |              *****|****      ||   |   |  |   |  |        |  ||  | |   |   |  |   ||||| |      ****|         |  |   ****       ||||          | |             |        |  || ||| |                 |   |   |   |   | |                     |   |     | |      | | ****||       || |    |||  |  | |                    | |     | |      | |                  | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | |                 |  |       | || |                            |  |   |  |     | |***                     ||| | |  ||  |       | |           |  | |  |     | |              |  | |          ||   |   |  |   |  |        |  ||  | |   |   |  |   ||||| |       |  |         |  |   |  |       ||||          | |             |        |  || ||| |                 |   |   |   |   ***                     |   |     | |      | | | ||||       || |    |||  |  | |                    | |     | |      | |                  | |            
search RasMol script viewer Motif-ligand binding stats  nest ..     | |                 |  |       | || |                            |  |   |  |     | |                        ||*** |  ||  |       ***           |  | |  |     ***              |  ***          ||   |   |  |   |  |        |  ||  | |   |   |  |   ****| |       |  |         |  |   |  |       ****          ***             |        |  || ||***                 |   |   |   |                           |   |     ***      | | | ||||       |***    ***  |  ***                    ***     ***      | |                  ***            
search RasMol script viewer Motif-ligand binding stats  niche ..     | |                 ****       ******                            ****   ****     | |                        ||    ********                     **** ****                      |    |          ||   |   ****   ****        ******** |   |   |  |   |******       ****         ****   ****                                     |        ********                    |   |   |   |                           |   |              *** ******       |        |****                                          ***                                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..     | |                                                                              | |                        ||                                                                ******          ||   |                               |   |   |  |   |                                                                          |            | |                     |   |   |   |                           |   |                  | | |        |        |                                                                                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..     | |                                                                              | |                        ||                                                                                ||   |                               *****   |  |   |                                                                          |            | |                     *****   |   |                           |   |                  *****        |        |                                                                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..     | |                                                                              | |                        ||                                                                                |*****                                   *****  *****                                                                          |            | |                             *****                           *****                  | |          |        |                                                                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                                                                              ***                        ||                                                                                ||                                                                                                                             |            ***                                                                                    ***          |        |                                                                                  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                 **                                                                                **                                                                                                                             *                                                                                                                *        *                                                                                  

   New search    2wsl:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors