triangle PDBeMotif: 2w9z  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.11.22
Classification transferase    | release date: Fri, Jan 30, 2009
Title crystal structure of cdk4 in complex with a d-type cyclin
Authors A.CLEASBY, C.LENGAUER, F.P.HOLDING, H.JHOTI, I.J.TICKLE, J.E.COYLE, J.YON, M.O.REILLY, P.J.DAY, R.CHOPRA, R.L.MCMENAMIN
Method X-RAY DIFFRACTION (resolution: 2.45Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPV
KKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEEN
KQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEAL
LESSLRQAQQNMDPKAA
Chain B sequence:
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRT
DREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLAR
IYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVS
LPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : G1/S-SPECIFIC CYCLIN-D1
member of: CATH:search1.10.472.10GENE3D:searchG3DSA_1.10.472.10PANTHER:searchPTHR10177/searchPTHR10177_SF67PFAM:searchPF00134/searchPF02984PROSITE PATTERNS:searchPS00292, SMART:searchSM00385SUPERFAMILY:searchSSF47954UniProt:searchP24385
sec str:  ..hhhhhhhhhhhhhhhh.....hhhhhh....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh....hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..LLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMD
seq num:  ..22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |  || | | |  |  |  || ^**          || |||              || ||  |  |  |   |      |  |    |   |  || |^**           || ||||  | |  ||    |  |  |  ||    |   |    |  |  |  ||  ||  |    |       | ||||  || |   || |||              | | ^**       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  || | | |  |  |  ||  ||          || |||              || ||  |  |  |   |      |  |    |   |  || |||            || ||||  | ^***|    |  |  |  ||    |   |    |  |  |  ||  ||  |    |       | ||||  || |   || |||              | | ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  || | | |  |  |  ||  ||          || |||              || ||  |  |  |   |      |  |    |   |  || |||            || ||||  | |  ||    |  |  |  ||    |   |    |  |  |  ||  ||  ^*****       | ||||  || |   || |||              | | ||        
search RasMol script viewer Motif-ligand binding stats  CYCLINS ..           |  || | | |  |  |  ||  |********************************| ||  |  |  |   |      |  |    |   |  || |||            || ||||  | |  ||    |  |  |  ||    |   |    |  |  |  ||  ||               | ||||  || |   || |||              | | ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           ***** | | |  |  |  |*****          || |||              *****  |  |  |   |      |  |    |   ***** |||            || ||||  | *****    |  |  *****    |   |    |  |  |  |*****               | ||||  || |   || |||              | | ||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****  | | |  |  |  |****           |****|              ****|  ****  |   |      |  |    |   ********|            |****||  | ****|    |  |  ****     |   |    ****  |  |****                ****||  || |   |****|              | ****        
search RasMol script viewer Motif-ligand binding stats  nest ..              |  | | |  |  |  |               |  ***               |  |        |   |      |  |    |   |   *****            |  ***|  | |   |    |  |           |   |    |  |  |  |                      ***|  |***   |  ***              |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..              **** | |  *******               |    |               ****        |   |      ****    |   |                    |    |**** |   |    ****           |   |    ****  ****                         ****  |   |    |              |   |         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   | |                        ******                           |   |              |   |                    ******     |   |                   |   |                                             |   ******              |   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                   | |                                                         |   |              *****                               *****                   |   |                                             |   |                   |   |         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                   | |                                                         *****                                                                          *****                                             *****                   *****         
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ***                                                                                                                                                                                                                                

chain B : CELL DIVISION PROTEIN KINASE 4
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24056/searchPTHR24056_SF129PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP11802
sec str:  .......eeeeeeeee..eeeeeee......eeeeeeeeee......hhhhhhhhhhhhhhhhhh......eeeeeeeee...eeeeeeeee...eehhhhhhh.......hhhhhhhhhhhhhhhhhhhhh...........eee......ee....hhhhhhhhhhhh.........hhhhhhh....hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhh............ ......................hhhhhhhhhhhh........hhhhhh.....
sequence :  ..ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR... ..PRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL
seq num:  ..2         12        22        32        42        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235   ... ..245       255       265       275       285        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |||||    |  |  | |    |  | |    || |      |    | ||  |  | | |||  |        ||||||               || ||          | ||              | | |||||| || |   |||||  || |      |  |    || ||        | || ||  | |    |       | | | || |  || ||    |  |  ..PS00004..        | |  | | | |  |  || |   | || **^*          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**||    |  |  | |    |  | |    |^**      |    ^**|  |  | | |||  |        ^**^**               || ||          ^**|              | | |||||| || |   |^**|  || |      |  |    || ||        | || ||  | |    |       | | | || |  || ||    |  |  ..PS00005..        | |  | | | |  |  || |   | ||  |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***    |  |  | |    |  | |    |         |    ^***  |  | | |||  |         ^***                |^***          ^***              | | |||||| || |   | | |  || |      |  |    || ||        | |^***  | |    |       | | ^*** |  || ||    |  |  ..PS00006..        | |  | | | |  |  || |   | ||  |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | |     |  ^*****    |  | |    |         ^*****     |  | | |||  |                             |  ||                            | | |||||| || |   | | |  || |      |  |    || ||        | |  |   | ^*****       | ^***** |  || ||    |  |  ..PS00008..        | |  | | | |  |  || |   | ||  |            
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..  | |     ************************                    |  | | |||  |                             |  ||                            | | |||||| || |   | | |  || |      |  |    || ||        | |  |   |              | | | |  |  || ||    |  |  ..PS00107..        | |  | | | |  |  || |   | ||  |            
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..  | |        |  |      |  | |                         |  | | |||  |                             |  ||                            | ****^********   | | |  || |      |  |    || ||        | |  |   |              | | | |  |  || ||    |  |  ..PS00108..        | |  | | | |  |  || |   | ||  |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |        |  |      |  | |                         |  | | |||  |                             *****                            | | |||||| || |   | | |  || |      |  |    || ||        | |  |   |              | | | |  ********    |  |  ..alphabetamotif..        | |  | | | |  ***** |   | ||  |            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  | |        |  |      ******                         |  | | |||  |                             |  |                             | | |||||| || |   | | |  || |      |  |    || ||        | |  |   |              | | | |  |  |  |     |  |  ..betabulgeloop..        | |  | | | |  |  |  |   | ||  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |        ****         | |                         |  | ****|  |                             ****                             | | |||||| || |   | | |  || |      |  |    || ||        | |  |   |              | | | |  *******     |  |  ..betaturn..        | |  | | | |  ****  |   | ||  |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |                     | |                         |  |   | |  |                                                              | | |||||| || |   | | |  || |      |  |    || ||        | |  |   |              *** | |              |  |  ..gammaturn..        ***  | | | |        |   | ||  |            
search RasMol script viewer Motif-ligand binding stats  nest ..  | |                     ***                         |  |   ***  |                                                              *** ****|| || |   *** |  |***      |  |    || ||        ***  |   |                  | |              |  |  ..nest..             *** | |        |   | ||  |            
search RasMol script viewer Motif-ligand binding stats  niche ..  ***                                                 ****     ****                                                                   ***|**** |       ****         ****    |****             |   |                  | |              ****  ..niche..                 ***        |   *******            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                       | || |  |                            |  |              *****                  | |                    ..ststaple..                            *****                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                       | || |  |                            |  |                                     ***                    ..stturn..                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                       * ** *  *                            *  *                                                            ..REP00000..                                                   

   New search    2w9z:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors