triangle PDBeMotif: 2w5h  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.11.1
Classification transferase    | release date: Wed, Dec 10, 2008
Title human nek2 kinase apo
Authors R.BAYLISS
Method X-RAY DIFFRACTION (resolution: 2.33Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT
TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF
GLARILNHDTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SERINE/THREONINE-PROTEIN KINASE NEK2
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24362PFAM:searchPF00069PROSITE PATTERNS:searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP51955
sec str:  ...hhh.eeeeeeeeee..eeeeeeee.....eeeeeeee.hhh..hhhhhhhhhhhhhhhh.......eeeeeee....eeeeeee....eehhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee..hhhhh... ..hhhhhhhhhh......hhhhhh....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.........hhhhhhhhhhhh..hhhhh.hhhhhhh....hhhhh...
sequence :  ..SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRS..HRDLKPANVFLDGKQNVKLGDFGLAR... ..HDTSFAKAFVGTPYYMSPEQMN..SYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123      ..139       149       159   ... ..168       178         ..192       202       212       222       232       242       252       262       272     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| || |                 | ||| |       |||||||  ||   |   || || |  |        |  ^***        | |  ||  ||| ||||         |   |     |   |..  | || || || | |      |  |..PS00001..       |  |||  |  |  |..| |||||| |         | |      | ||      | |    |  ||   |   ||  | || || |  ||  | || |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| || |                 **^*| |       |||||||  ||   |   || || |  |        |  | |         | |  ||  ||| ||||         |   |     |   |..  | || || || | |      |  |..PS00004..       |  |||  |  |  |..| |||||| |         | |      | ||      | |    |  ||   |   ||  | || || |  ||  | || |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || |                     | |       |||||||  ||   |   || || |  |        |  | |         | |  ||  ||| ||||         |   |     |   |..  | || || || | |      |  |..PS00005..       |  |||  |  |  |..| |||||| |         | |      ^**|      | |    |  ||   |   ||  | || || |  ||  | || |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^*** |                     | |       |||^***  ||   |   || || |  |        |  | |         | |  ||  ||| ||||         |   |     |   |..  | || || || | |      |  |..PS00006..       |  |||  |  |  |..^***|||| |         | |      ^***      | |    |  ||   |   ||  | || || ^***|  | || |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |                     | |       ||| ||   ||   |   || || |  |        |  | |         | |  ||  *******^         |   |     |   |..  | || || || | |      |  |..PS00007..       |  |||  |  |  |..  |||||| |         | |      | |       | |    |  ||   |   ||  | || ||     |  | || |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |                     | |       ||| ||   ||   |   || || |  |        |  | |         ^*****|   || |||          |   |     |   |..  | || || || | |      |  |..PS00008..       |  |||  |  |  |..  |||||| |         | |      | |       | |    |  ||   |   ||  | || ||     |  | || |  |   
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..  |  |                     | |       ||| ||   ||   |   || || |  |        |  | |           |   |   || |||          |   |     |   |..**^********| | |      |  |..PS00108..       |  |||  |  |  |..  |||||| |         | |      | |       | |    |  ||   |   ||  | || ||     |  | || |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |                     | |       ||| ||   ||   |   || || |  |        |  | |           |   |   || |||          |   |     |   |..  | || ||  | | |      |  |..alphabetamotif..       |  |||  |  |  |..  |***** |         | |      | |       | |    |  ||   |   ||  | *****     |  | || |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |                     | |       ||| ||   ||   |   || || |  |        |  | |           *****   || |||          |   |     |   |..  | || ||  | | |      |  |..asxmotif..       |  |||  |  |  |..  *****  |         | |      | |       | |    |  ||   |   ||  | || ||     |  | || |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |                     | |       *** ||   ||   |   || || |  |        |  | |                   || |||          |   |     |   |..  | || ||  *** |      |  |..asxturn..       |  |||  |  |  |..  ***||  |         | |      | |       | |    |  ||   |   ||  ***| ||     |  ***| |  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |                     | |        |  ||   ||   |   || || |  |        ******                   || |||          |   |     |   |..  | || ||    | |      |  |..betabulgeloop..       |  |||  |  |  |..  || ||  |         | |      | |       | |    |  ||   |   ||  | || ||     |  |  | |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |                     | |        |  ||   ||   |   ****| |  |           | |                   |****|          |   |     |   |..  | ****|    | |      ****..betaturn..       |  |||  |  ****..  *****  |         | |      | |       | |    |  ||   |   ||  | ****|     |  |  | ****   
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                     ***        |  ||   ||   |    |  | |  |           ***                   |  ***          |   |     |   |..  | || ||    ***          ..nest..       |  |||  |      ..     |   |         ***      | |       ***    |  ||   |   ||  | ||  |     |  |  | |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                                ****|   ||   |    **** ****                                 |    |          |   |     |   |..  | |****                 ..niche..       ****|****      ..     |   |                  | |              ****|   |   |**********     ******* ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                          |   ||   |                                              ******          |   |     |   |..  | |  |                  ..schellmannloop..           |          ..     |   |                  | |                  |   |   |                              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                          *****|   |                                                              |   |     |   |..  | |  |                  ..stmotif..           |          ..     |   |                  | |                  *****   |                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                               *****                                                              *****     *****..  | |  |                  ..ststaple..           |          ..     *****                  | |                      *****                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                 ..  | |  |                  ..stturn..           |          ..                            ***                                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                 ..  * *  *                  ..REP00000..           *          ..                                                                                        

   New search    2w5h:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors