triangle PDBeMotif: 2w2q  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.
Classification hydrolase/receptor    | release date: Mon, Nov 3, 2008
Title pcsk9-deltac d374h mutant bound to wt egf-a of ldlr
Authors A.CALZETTA, A.CAR, A.CIRILLO, A.NOTO, A.SITLANI, C.P.SPARROW, F.TALAMO, J.BAYS, J.C.S, L.ORSATTI, L.RUGGERI, M.J.BOTTOMLEY, M.MATTU, P.LO SURDO, R.DE FRANCESCO, R.M.CUBBON, R.T.CUMMINGS, T.S.FISHER
Method X-RAY DIFFRACTION (resolution: 2.33Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain P sequence:
MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Chain A sequence:
SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSHCSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
Chain E sequence:
MKHHHHHHPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQ
LCVNLEGGYKCQCEEGFQLDPHTKACK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
member of: CATH:search3.40.50.200GENE3D:searchG3DSA_3.30.70.80/searchG3DSA_3.40.50.200PANTHER:searchPTHR10795/searchPTHR10795_SF333PFAM:searchPF00082PRINTS:searchSUBTILISINSUPERFAMILY:searchSSF52743UniProt:searchQ8NBP7
JMol viewer RasMol script viewer  CA 1448A  ..             ..                                   ..                                                                                                             *  * *                      * *                                                                                       
sec str:  ....hhhhhhhh........eeeeee.............eeeeeee...........hhhhhhhhhhhhh..........eeeee......eeehhhhhhhhhhhhhhhhhh....eeeee.eeee.hhhhhhhhhhhhhh..eeeee..........ee.......eeeeee.....................eeee...eeee......eeeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhee...hhhhhhhhhh.....ee......
sequence :  ..SIPWNLERITPPR..SLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEED..SKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSHCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPS
seq num:  ..153          ..178       188       198       208  ..221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |   ..|  |    |   |  || |||||  | ||      ..|  | ||    || ^**| |    |^**^**  | |||||   |     |   |                                | |       || | |  | | || ||   |    | |    |    | |  |            | ||  |     | |  |             |  ||  |    ||  ^**| ||| |||  ||  |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  |   ..^***    |   |  || |||||  ^***      ..^*** ||    || ^*** |    |        | |||||   |     |   |                                | |       || | |  | | ^***|   |    | |    |    | |  |            | ||  |     | |  |             |  |^***    ||  ^*** ||| |||  ||  |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |   ..        |   |  || |||||  | |       ..     |^*****|  ||  ^*****        | |||^*****     |   |                                | |       || | |  | |  |  |   ^***** |    ^***** |  |            | ||  |     ^*****             |  |        ||  |  | ||| |||  ||  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |   ..        |   |  || |||||  | |       ..     |      |  ||  |             | ||| |   |     |   |                                | |       || | |  | |  |  |        | |           |  |            | ||  |       |                |  |        ||  |  | ||| ||*****  |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      |  |   ..        |   |  || |||||  | |       ..     |      |  ||  |             ***** |   |     |   |                                | |       || | |  | |  |  |        | |           |  |            | ||  |       |                |  |        ||  |  | ||| |||  ||  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |   ..        |   |  || ****|  | |       ..     |      |  ||  |             ****| |   |     |   |                                | |       || | |  | |  |  |        | |           |  |            | ||  |       |                |  |        ||  |  | |****|****|  |          
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |   ..        |   |  ||  |***  | |       ..     |      |  ||  |               *** |   |     |   |                                ***       |*** |  | |  |  |        ***           |  |            | ||  |       |                |  |        ||  |  *** |  |   ||  |          
search RasMol script viewer Motif-ligand binding stats  niche ..      ****   ..        |   ***********  ***       ..     |      ********                   |   |     |   |                                          |    **** *******                      ****            *******       |                ****        |****  *** ****   |****          
search RasMol script viewer Motif-ligand binding stats  ststaple ..             ..        |                | |       ..     |                                 *****     *****                                          |                                                      | |           |                            *****             *****          
search RasMol script viewer Motif-ligand binding stats  stturn ..             ..        |                ***       ..     |                                                                                          |                                                      ***           |                                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..             ..        *                          ..     *                                                                                          *                                                                    *                                                             

chain E : LOW-DENSITY LIPOPROTEIN RECEPTOR
member of: GENE3D:searchG3DSA_2.10.25.10/searchG3DSA_4.10.400.10PANTHER:searchPTHR10529/searchPTHR10529_SF195PFAM:searchPF00057/searchPF12662PROSITE PATTERNS:searchPS00010/searchPS01186/searchPS01187/searchPS01209, PROSITE PROFILES:searchPS50026/searchPS50068, SMART:searchSM00179/searchSM00181/searchSM00192SUPERFAMILY:searchSSF57184/searchSSF57424UniProt:searchP01130
JMol viewer RasMol script viewer  CA 1333E  ..        * *             *   *                  
sec str:  ...........hhhhhhhhhh..eeee....eeee.....eee...eee
sequence :  ..LYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCE
seq num:  ..286       296       306       316       326    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |    ||| ||  |    | |      | ||  |    | || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ^*****|| ||  |    | |      | ||  |    | || 
search RasMol script viewer Motif-ligand binding stats  ASX_HYDROXYL ..         ||| ||  |    **^*********|  |    | || 
search RasMol script viewer Motif-ligand binding stats  EGF_2 ..         ||| ||  |             ^*^***********^ 
search RasMol script viewer Motif-ligand binding stats  EGF_CA ..         ||| ||  |                |  |    | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..         *** ||  |                |  |    | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |****                ****    | |  
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |                    |  |    ***  
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                    ****         

chain P : PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
member of: GENE3D:searchG3DSA_3.30.70.80PANTHER:searchPTHR10795/searchPTHR10795_SF333PFAM:searchPF05922SUPERFAMILY:searchSSF52743/searchSSF54897UniProt:searchQ8NBP7
sec str:  ....eee...hhh...............hhhhhhhhhhhhhhhhhhh.....................hhhhhhhhhh...eeeeeeeeeeee.
sequence :  ..TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
seq num:  ..61        71        81        91        101       111       121       131       141         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  | ||  ||  |     |  |  | ^**^**      | |||         |    |    | |    |  |  |||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  | ||  ||  |     |  |  ^***          | |||         |    |    | |    |  |  |||          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****  | ||  ||  |     |  |                | |||         ^*****    | |    |  |  |||          
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | ||  ||  |     |  |                | |||                   | |    |  |  |**          
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | ||  ||  |     ****                ****|                   | |    |  |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..      | ||  ||  |     |  |                  ***                   | |    |  |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..      ***********     ****                                        | |    *******            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                  ***                       

   New search    2w2q:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors