triangle PDBeMotif: 2vzi  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification cell adhesion    | release date: Fri, Aug 1, 2008
Title crystal structure of the c-terminal calponin homology domain of alpha-parvin in complex with paxillin ld4 motif
Authors E.D.LOWE, I.D.CAMPBELL, I.VAKONAKIS, M.E.M.NOBLE, M.K.H, S.LORENZ
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search PG4 PG4 binding statistics PG4   search PGE PGE binding statistics PGE   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ATRELDELMASLSDFKFMAQ
Chain B sequence:
SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFE
QKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PAXILLIN
member of: PANTHER:searchPTHR24216/searchPTHR24216_SF11UniProt:searchP49023
JMol viewer RasMol script viewer  EDO 1374B  ..             
sec str:  ..hhhhhhhhhhhhh
sequence :  ..ATRELDELMASLS
seq num:  ..1         11 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | ^**
search RasMol script viewer Motif-ligand binding stats  ststaple ..        *****

chain B : ALPHA-PARVIN
member of: CATH:search1.10.418.10GENE3D:searchG3DSA_1.10.418.10PANTHER:searchPTHR12114/searchPTHR12114_SF6PFAM:searchPF00307PIRSF:searchPIRSF039131PROSITE PROFILES:searchPS50021, SMART:searchSM00033SUPERFAMILY:searchSSF47576UniProt:searchQ9NVD7
JMol viewer RasMol script viewer  PGE 1377B  ..                                                                                         *                                    
JMol viewer RasMol script viewer  EDO 1376B  ..                                                                                       * |  *  *                 *  **        
JMol viewer RasMol script viewer  PGE 1375B  ..                                          *  * **                   *                  | |  |  |                 |  ||        
JMol viewer RasMol script viewer  EDO 1374B  ..                        *  **             |  | ||                   |                  | |  |  |                 |  ||   ** * 
JMol viewer RasMol script viewer  PG4 1373B  ..                        |  ||             | ** ||                   |  ***  *          | |  |  |       *         |  ||   || | 
sec str:  ...hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh...hhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhh.hhhhhhhhhhhhhhhh....
sequence :  ..RDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
seq num:  ..247       257       267       277       287       297       307       317       327       337       347       357       367   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |  |                       | |  |  |    ||||     |  | |            |   || ^***       | |         | |||   | |        |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |                       | |  |  |    ||||     |  | |            |   ||   |        | |         | |||   ^**        |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***                       | |  ^***    ||||     |  | |            |   ||   |        | |         | |||              |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                | |          ||||     ^*****            |   ||   |        | |         | |||              |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                | |          ||||        | |            |   ||   |        | |         ****|              |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..                                ***          ****        ***            |   ||   |        ***           ***              |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                        |   ||   |                                       **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                        *****|   |                                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                             *****                                            

   New search    2vzi:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors