triangle PDBeMotif: 2v10  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.23.15
Classification hydrolase    | release date: Mon, May 21, 2007
Title crystal structure of renin with inhibitor 9
Authors F.CUMIN, H.RUEGER, J.M.WOOD, J.MAIBAUM, J.RAHUEL, M.G.GRUTTER, N.C.COHEN, R.GOSCHKE, S.STUTZ, V.RASETTI, W.FUHRER
Method X-RAY DIFFRACTION (resolution: 3.10Å)
PDBe Citation   
Small molecules:    search C61 C61 binding statistics C61
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains C,O sequence:
LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELT
LRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSF
YYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIE
KLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFI
RKFYTEFDRRNNRIGFALAR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : RENIN
member of: GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF77PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00797
JMol viewer RasMol script viewer  C61 1341C  ..              ***               * * *                                         ***                                 **    *  *                                        ..C61 ..                                                        **                                                                                                                
sec str:  .................eeeeeeee....eeeeeeee.....eeee.......hhhhhh....hhhhh...eeeeeeeeeee..eeeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhhh.................... .................................eeee..eee..eeee....eeeee......eeehhhhhhhhhhhhh........eee.........eeeee..eeeeehhhhhh.........eee..eee..........eeehhhhhh...................
sequence :  ..GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSE... ..SLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164 ... ..171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|^***|     | |||            | ||  ||||    | | ||||||| || |    |  | ||| ^*** ||||  |    |         |    |            |  | |        |  |         |  ||    | |          ..PS00001..           | |               | |    |    |          |  || |    |  | ||     | | | |         | |  |    |  |    | || |     | |            | |||         |  | |  | || |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |     | |||            ^**|  ||||    | ^**|||||| || |    |  | ^** |||  ^**|  |    |         |    |            |  | |        |  |         |  ||    | |          ..PS00005..           | |               | |    |    |          |  || |    |  | ||     | | | |         | |  |    |  |    | || |     ^**            | |||         |  | |  | || |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |     | |||               |  ||||    | |  |||||| || |    |  |  |  |||   | |  |    |         |    |            |  | |        |  |         |  ||    | |          ..PS00006..           | |               | |    |    |          |  || |    |  ^***     | | | |         | ^***    |  |    ^*** |                    | |||         |  | ^*** || |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     | |||               |  ||||    | |  |||||| || |    |  |  |  |^***** |  ^*****         ^*****            |  | |        |  |         |  ||    | |          ..PS00008..           | |               | |    ^*****          |  || |    ^*****      | | | |         | |       |  |      |  |                    | |||         |  |    | || |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..           | |||               ***^******** |  |||||| || |    |  |  |  | |     |                                   |  | |        |  |         |  ||    | |          ..PS00141..           | |               | |                    ***^********           | | | |         | |       |  |      |  |                    | |||         |  |    | || |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |||                  ||||      |  |||||| || |    |  |  |  | |     |                                   |  | |        |  |         *****    | |          ..alphabetamotif..           | |               | |                       || |                | | | |         | |       |  |      |  |                    | |||         |  |    | || |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |||                  ***|      |  |||||| || |    |  |  |  ***     |                                   |  | |        |  |         |  |     | |          ..asxturn..           ***               | |                       || |                | | | |         | |       |  |      |  |                    | |||         |  |    ***| |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****|                  || |      ****||||**** |    |  |  |          |                                   |  | |        |  |         ****     | |          ..betaturn..                             | |                       || |                | | | |         | |       ****      |  |                    ****|         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |                  || |      |  |||||  |  |    |  |  |          |                                   |  | |        |  |                  ***          ..gammaturn..                             ***                       || |                | | | |         ***                 |  |                      | |         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  nest ..             ***                  || |      |  |||||  |  |    |  |  |          |                                   |  | |        |  |                               ..nest..                                                       || |                *** ***                             |  |                      | |         |  |       ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                  ****      ****|***  ****    *******          |                                   ******        ****                               ..niche..                                                       ****                                                    ****                      ***         ****                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                  || |          ***                            |                                                                                    ..stturn..                                                       ||                                                                                                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                  ** *                                         *                                                                                    ..REP00000..                                                       **                                                                                                                 

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain O : RENIN
member of: GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF77PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00797
JMol viewer RasMol script viewer  C61 1341O  ..              **               * * *                                         ****                                   **    *         *                        *    ..C61 ..                                                     * ***                                                                                                                
sec str:  .....eeee.eee...eeeeeeee....eeeeeeee.....eeee.......hhhhhh.................eeeee....eeeeeee..eeee..eeee..eeeeee............eeee............hhhhhhhh.......eeeeee....... .....eeeee...hhh.eeeeeeeee.......eeeeeeeee..eeee....eeeee......eeehhhhhhhhhhhhh.ee....eeee.hhhhhh..eeeee..eeeeehhhhhee........eeee.eee..........eeehhhhhh.eeeeee....eeeeeee.
sequence :  ..NTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDS... ..SLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155         ... ..171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..^***|     | |||            | ||  || |    | | ||| ||| |||    | | | ||| ^*** ||||  |    |       ||||   |            |  | |    | | |  |          |  |||| | |         ..PS00001..            |  |                    |    |          |  || |    |  | || |  || |          |  | || |            | || || || | ||                              |  | || |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |     | |||            ^**|  || |    | ^**|| ||| |||    | | | ^** |||  ^**|  |    |       ||||   |            |  | |    | | |  |          |  |||| | |         ..PS00005..            |  |                    |    |          |  || |    |  | || |  || |          |  | || |            | || || || ^**|                              |  | || |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |     | |||               |  || |    | |  || ||| |||    | | |  |  |||   | |  |    |       ||||   |            |  | |    | | |  |          |  |||| | |         ..PS00006..            |  |                    |    |          |  || |    |  ^*** |  || |          |  | ^***            ^*** || || |  |                              ^*** || |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*****     | |||               |  || |    | |  || ||| |||    | | |  |  |^***** |  ^*****       ||^*****            |  | |    | | |  |          |  |||| | |         ..PS00008..            |  |                    ^*****          |  || |    ^*****  |  || |          |  |  |                |  || || |  |                                 | || |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..          | |||               ***^******** |  || ||| |||    | | |  |  | |     |               || |                |  | |    | | |  |          |  |||| | |         ..PS00141..            |  |                                    ***^********       |  || |          |  |  |                |  || || |  |                                 | || |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |||                  || |      |  || |******    | | |  |  | |     |               || |                |  | |    | | |  |          |  |||| | |         ..alphabetamotif..            |  |                                       || |            ***** |          |  |  |                |  || || |  |                                 | || |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | |||                  || |      |  || ||| ||     *** |  |  ***     |               || |                |  | |    | | |  |          |  |||| | |         ..asxturn..            |  |                                       || |            |  || |          |  |  |                |  || || |  |                                 ***| |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****|                  || |      ****| |*****         |  |          |               ****                **** |    | | ****          ****||| | |         ..betaturn..            |  |                                       || |            ****| |          ****  |                |  || || |  |                                    | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | |                  || |      |  || ||             |  |          |                | |                |  | |    | | |  |             |||| ***         ..gammaturn..            |  |                                       || |                | |             |  |                |  |***| |  |                                    | |       
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                  || |      |  || ||             |  |          |                | |                |  | |    | | |  |             ****             ..nest..            |  |                                       || |                ***             |  |                |  |   | |  |                                    ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                 || |      ********             ****          |                ***                ******    *** ****                              ..niche..            ****                                       ****                                ****                ****   ******                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                 || |          ***                            |                                                                                   ..stturn..                                                       ||                                                                                                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                 ** *                                         *                                                                                   ..REP00000..                                                       **                                                                                                                 

   New search    2v10:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML