triangle PDBeMotif: 2ux2  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification immune system    | release date: Mon, Mar 26, 2007
Title high resolution structure of human cd59
Authors B.P.MORGAN, K.J.LEATH, P.ROVERSI, R.A.G.SMITH, S.JOHNSON, S.M.LEA
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CD59 GLYCOPROTEIN
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PANTHER:searchPTHR10036/searchPTHR10036_SF6PFAM:searchPF00021PROSITE PATTERNS:searchPS00983, SMART:searchSM00134SUPERFAMILY:searchSSF57302UniProt:searchP13987
sec str:  ....eee...........eee......eeeeeee..eeeeeeehhhhhhhhhhhhhhh....eeeee......hhhhh..
sequence :  ..MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
seq num:  ..0         10        20        30        40        50        60        70      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  ||  |      | |  ^*** || |     | |      || || ||  ||||||     |   | ||| |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||  |      | |   ||| || |     | |      || || ||  ^**|||     |   | ||| |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ||  |      | |   ||^*** |     | |      || || ||  || |||     |   | ||| |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  ||  |      | |   ||  |  |     | |      || || ||  || |*******^   | ||| |  |  
search RasMol script viewer Motif-ligand binding stats  LY6_UPAR ..  *^**^******^*****^******^******************^ ||  || | |         | ||| |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |    |  |        | |      ***** ||  || | |         ****| |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..             | |    |  |        | |            ||  || ***           *** |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..             ***    ****        ***            ||  ||                   ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                               ******                         

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : CD59 GLYCOPROTEIN
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PANTHER:searchPTHR10036/searchPTHR10036_SF6PFAM:searchPF00021PROSITE PATTERNS:searchPS00983, SMART:searchSM00134SUPERFAMILY:searchSSF57302UniProt:searchP13987
sec str:  ....eee...........eee......eeeeeee..eeeeeeehhhhhhhhhhhhhhh....eeeee......hhhhhh.
sequence :  ..MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
seq num:  ..0         10        20        30        40        50        60        70      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  ||  |      | |  ^*** || |     | |      || |||||  ||||||     |   | |||  |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||  |      | |   ||| || |     | |      || |||||  ^**|||     |   | |||  |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ||  |      | |   ||^*** |     | |      || |||||  || |||     |   | |||  |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  ||  |      | |   ||  |  |     | |      || |||||  || |*******^   | |||  |  | 
search RasMol script viewer Motif-ligand binding stats  LY6_UPAR ..  *^**^******^*****^******^******************^|||  || | |         | |||  |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..             | |    |  |        | |      || ||***  || | |         | |||  |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |    |  |        | |      ***** ||  || | |         ****|  **** 
search RasMol script viewer Motif-ligand binding stats  nest ..             | |    |  |        | |            ||  || ***           ***       
search RasMol script viewer Motif-ligand binding stats  niche ..             ***    ****        ***            ||  ||                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                               ******                         

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : CD59 GLYCOPROTEIN
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PANTHER:searchPTHR10036/searchPTHR10036_SF6PFAM:searchPF00021PROSITE PATTERNS:searchPS00983, SMART:searchSM00134SUPERFAMILY:searchSSF57302UniProt:searchP13987
sec str:  ....eee...........eee......eeeeeee..eeeeeeehhhhhhhhhhhhhhh....eeeee......hhhhh..
sequence :  ..MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
seq num:  ..0         10        20        30        40        50        60        70      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  ||  |      | |  ^*** || |     | |      || || ||  ||||||     |   | ||| |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||  |      | |   ||| || |     | |      || || ||  ^**|||     |   | ||| |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ||  |      | |   ||^*** |     | |      || || ||  || |||     |   | ||| |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  ||  |      | |   ||  |  |     | |      || || ||  || |*******^   | ||| |  |  
search RasMol script viewer Motif-ligand binding stats  LY6_UPAR ..  *^**^******^*****^******^******************^ ||  || | |         | ||| |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |    |  |        | |      ***** ||  || | |         ****| |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..             | |    |  |        | |            ||  || ***           *** |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..             ***    ****        ***            ||  ||                   ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                               ******                         

   New search    2ux2:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors