triangle PDBeMotif: 2stt  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification dna binding protein/dna    | release date: Mon, Aug 5, 1996
Title solution nmr structure of the human ets1/dna complex, 25 structures
Authors A.M.GRONENBORN, G.M.CLORE, M.H.WERNER
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDK
NIIHKTAGKRYVYRFV
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |       |  ||||||^**|  ||            || | |  ||||||||   || ||||||| |||       | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |       |  |||||| | |  ||            ^*** |  ||||||||   || ||||||| |||       | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       | |       |  |||||| | |  ||             | | |  |^***|||   || ||||||| |||       ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..       | |       ********* | |  ||             | | |  |||| |||   || ||||||| |||         |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..       | |       |  |||||| | |  ||             | | |  |||| ||****************||         |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |       ********| | *****             | | *****|| |||   |********| |||         |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |       |  | || | ***  |              | | |  | || |||   || || |||| |||         |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |       *********   ****              | | **********|   *************|         |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |                                     ***      |  | |              ***         |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                                              |  ***                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        |    |                          ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || |       | || ||||^**||||             || | || |||||| |   |  || |||| ||        | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || |       | || |||||  ||||             ^*** || |||||| |   |  || |||| ||        | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  || |       | || |||||  ||||              | | || |^***| |   |  || |||| ||        ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  || |       *********|  ||||              | | || |||| | |   |  || |||| ||          |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  || |         || |||||  ||||              | | || |||| | ****************|          |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ***** |         |*******  ||||              | | |*****| | |   |  |*****| ||          |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****| |         *******   ||||              | | ********* |   ************|          |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |                   ||||              ***         | |            |  |          |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                   ****                          ***            |  |          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                          ****          ****    

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |  || || |    | |||||||^**                 || | || ||||||||  ||  |    |  |  | |    | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |  || || |    | |||||||                    ^*** || ||||||||  ||  |    |  |  | |    | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | |  || || |    | |||||||                     | | || |^***|||  ||  |    |  |  | |    ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 .. | |  || || |    *********                     | | || |||| |||  ||  |    |  |  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 .. | |  || || |    | |||||||                     | | || |||| ||****************  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |  || || |    ********|                     | | |*****| |||  ||  |    |  |  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn .. | ****| || |    *********                     | | *****|************    ****  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***   | || |                                  ***      |  | |  |           |  ***      |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***| |                                           |  ***  |           |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                                           |    ****           ****        ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || |||  |  |   |    || |^**||||           | || |  |  || || |      || |||  |  |      |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  || |||  |  |   |    || ||  ||||           | ^***  |  || || |      || |||  |  |      |  | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  || |||  |  |   |    || ||  ||||           | || |  |  ^***| |      || |||  |  |      ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..  || |||  |  |   *********|  ||||           | || |  |  || || |      || |||  |  |         | |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..  || |||  |  |        || ||  ||||           | || |  |  || || ****************  |         | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ******  |  |        || ||  ||||           | || |  ***** || |      ******  |  |         | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..  *****   ****        *****  ||||           | || |  *******| |      *********  |         | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             ||||           ******         | |              |  |         | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                             ****                          ***              |  |         | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                            ****         ***    

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || ||| || |    | |  |  |^** |             | |  |  || |||||||    |  |  ||| || | |    |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  || ||| || |    | |  |  | |  |             | ^***  || |||||||    |  |  ||| || | |    |  | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  || ||| || |    | |  |  | |  |             | |     || ^***|||    |  |  ||| || | |    ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..  || ||| || |    ********* |  |             | |     || ||| |||    |  |  ||| || | |       | |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..  || ||| || |      |  |  | |  |             | |     || ||| ||****************| | |       | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ****** || |      |  |  | |  |             | |     |***** |||    |  *****| || | |       | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..  *****| || |      ******* ****             | |     *********|    ************ | |       | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |***                               ***         |  | |              |  ***       | |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                                              |  ***              |  |         | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        |    |              ****         ***    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || |||  | |    |    || |^**                 || |  |  |||||||      |  | |  |  |      |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  || |||  | |    |    || ||                   ^***  |  |||||||      |  | |  |  |      |  | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  || |||  | |    |    || ||                    | |  |  ^***|||      |  | |  |  |      ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..  || |||  | |    *********|                    | |  |  ||| |||      |  | |  |  |         | |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..  || |||  | |         || ||                    | |  |  ||| ||****************  |         | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ******  | |         || ||                    | |  *****| |||      |  | |  |  |         | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..  *****   | |         *****                    | |  **** ****|      **** ****  |         | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          ***                                  ***         | |              |  |         | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                           ***              |  |         | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                            ****         ***    

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || || |    |   |  ||^**||||||           || | || |||||||| | | ||  ||  ||| | |    |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || || |    |   |  ||   ||||||           ^*** || |||||||| | | ||  ||  ||| | |    |  | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  || || |    |   |  ||   ||||||            | | || |^***||| | | ||  ||  ||| | |    ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  || || |    *********   ||||||            | | || |||| ||| | | ||  ||  ||| | |       | |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  || || |        |  ||   ||||||            | | || |||| ||****************| | |       | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ***** || |        *****   |*****            | | || |||| ||| | | |*****  | | | |       | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  || || |        |  |    |||||             | | || |||| ||| | ***|  |   | | | |       | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****| || |        ****    |****             | | **********| |    ****   | | | |       | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |***                ||||              ***         | | |           *** ***       | |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                   ****                          *** |             | |         | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             ***             ***         ***    

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || |       |  | || |^**||||             |  |  | ||||||||    | ||||||| || |      |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || |       |  | || |   ||||             ^***  | ||||||||    | ||||||| || |      |  | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  || |       |  | || |   ||||                   | |^***|||    | ||||||| || |      ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  || |       *********   ||||                   | |||| |||    | ||||||| || |         | |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  || |          | || |   ||||                   | |||| ||****************| |         | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  || |          | || |   ||||                   *****| |||    ********| || |         | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****| |          ******   ||||                   *********|    ************ |         | |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                   ****                          ***              |  |         | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                            ****         ***    

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  ||         | |||||||^**||||||         | || |    ||||||||   | || ||||||| |       | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  ||         | |||||||   ||||||         | ^***    ||||||||   | || ||||||| |       | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  ||         | |||||||   ||||||         | || |    |^***|||   | || ||||||| |       ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  ||         *********   ||||||         | || |    | ||||||   | || ||||||| |         |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  ||           |||||||   ||||||         | || |    | |||||**************** |         |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****           *******   |*****         | || |    *****|||   | |********* |         |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |            ||||||    |||||          | || |    | || |||   ***| |||| || |         |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****            ******    |****          | || |    *******|      ********* |         |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             ||||           ******      |  | |              ***         |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..                             ****                       |  ***                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        |    |                          ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | || |    | |  || |^**||||           | || |  | |||||| |    |  ||  |  |  |      |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | || |    | |  || |   ||||           | ^***  | |||||| |    |  ||  |  |  |      |  | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       | || |    | |  || |   ||||           | || |  | |^***| |    |  ||  |  |  |      ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..       | || |    *********   ||||           | || |  | |||||| |    |  ||  |  |  |         | |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..       | || |      |  ||     ||||           | || |  | |||||| ****************  |         | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | || |      *****     ||||           | || |  *******| |    *****  |  |  |         | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | || |      ****      ||||           | || |  ****** | |    ****   ****  |         | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | || |                ||||           ******         | |              |  |         ***    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***| |                ****                          ***              |  |                
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                                                               ****                

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || || |    |   || ||^**||||||           || | || ||||||||      || |||  |  | |    |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || || |    |   || |||  ||||||           ^*** || ||||||||      || |||  |  | |    |  | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  || || |    |   || |||  ||||||            | | || |^***|||      || |||  |  | |    ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  || || |    *********|  ||||||            | | || |||| |||      || |||  |  | |       | |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  || || |        || |||  ||||||            | | || |||| ||****************  | |       | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  || || |        ******  |*****            | | |*****| |||      ******  |  | |       | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****| || |        *****   |****             | | *****|****|      *********  | |       | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |***                ||||              ***      |  | |              |  ***       | |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                   ****                       |  ***              |  |         | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        |    |              ****         ***    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || || |    | |  || |^**               | |  |  |  |||||||   | ||| |||| || |     || || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || || |    | |  || |                  | ^***  |  |||||||   | ||| |||| || |     || || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  || || |    | |  || |                  | |     |  ^***|||   | ||| |||| || |     |^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  || || |    *********                  | |     |  ||| |||   | ||| |||| || |     |  |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  || || |      |  || |                  | |     |  ||| ||****************| |     |  |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ***** || |      ***** |                  | |     *****| |||   | ||*****| || |     |  |  |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  || || |      |  |  |                  | |     |  ||| |||   ***** |||| || |     |  |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  || || |      |  |  |                  | |     |  ||| |||   ***|| |||| || |     |  |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****| || |      *******                  | |     ****|****|   ************* |     |  |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | || |                               ***         |  | |              |  |     |  |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***| |                                           |  ***              |  |     |  |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                                           |    |              ****     *******    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       ||||      |  | || |^**        | |      || |  | ||||||||  |   |  |||  |  | |    | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       ||||      |  | || ||          | |      ^***  | ||||||||  |   |  |||  |  | |    | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       ||||      |  | || ||          | |       | |  | |^***|||  |   |  |||  |  | |    ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..       ||||      *********|          | |       | |  | |||| |||  |   |  |||  |  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..       ||||         | || ||          | |       | |  | |||| ||****************  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ||||         | || ||          | |       | |  *****| |||  |   *****|  |  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ||||         *******          | |       | |  *********|  |   **** ****  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |***           |   |          | |       ***      |  | |  |           |  ***      |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***            |   |          | |                |  ***  |           |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                      |   |          | |                |    ****           ****        ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                      |   |          | |                ******                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                      *****          | |                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                     ***                                                        

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || ||| || |    | |  |  |^**||||             || |  || |||||||   |  || |||| || | |    |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  || ||| || |    | |  |  |   ||||             ^***  || |||||||   |  || |||| || | |    |  | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  || ||| || |    | |  |  |   ||||              | |  || ^***|||   |  || |||| || | |    ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..  || ||| || |    *********   ||||              | |  || ||| |||   |  || |||| || | |       | |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..  || ||| || |      |  |  |   ||||              | |  || ||| ||****************| | |       | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****| || |      |  |  |   ||||              | |  ****** |||   |  ******| || | |       | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..  *****| || |      *******   ||||              | |  *********|   ************* | |       | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | || |                ||||              ***         | |              |  ***       | |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***| |                ****                          ***              |  |         | |    
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                                                               ****         ***    

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |||||      |  ||| ||^**||||||         | || | || ||||||||  ||  ||  ||| || |      | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |||||      |  ||| ||   ||||||         | ^*** || ||||||||  ||  ||  ||| || |      | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  |||||      |  ||| ||   ||||||         | || | || |^***|||  ||  ||  ||| || |      ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  |||||      *********   ||||||         | || | || |||| |||  ||  ||  ||| || |        |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  |||||      |  ||| ||   ||||||         | || | || |||| ||****************| |        |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |||||      *********   |*****         | || | || |||| |||  ||  |*****| || |        |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****||||      *********   |****          | || | *****|****|  |******** **** |        |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |***                  ||||           ******      |  | |  |           |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                   ****                       |  ***  |           |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        |    ****           ****        ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |||||      |    |  |^**               | || | || ||||||||   |  ||  ||| || | |    |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |||||      |    |  |                  | ^*** || ||||||||   |  ||  ||| || | |    |  | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  |||||      |    |  |                  | || | || |^***|||   |  ||  ||| || | |    ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  |||||      *********                  | || | || |||| |||   |  ||  ||| || | |       | |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  |||||           |  |                  | || | || |||| ||****************| | |       | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |||||           |  |                  | || | || |||| |||   |  |*****| || | |       | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****||||           ****                  | || | **********|   ************* | |       | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |***                                 ******      |  | |              |  ***       | |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                                              |  ***              |  |         | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        |    |              ****         ***    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |   | || |    ||  ||  |^**                 || | || ||||||||  || |  || || |  |      | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |   | || |    ||  ||  |                    ^*** || ||||||||  || |  || || |  |      | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | |   | || |    ||  ||  |                     | | || |^***|||  || |  || || |  |      ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 .. | |   | || |    *********                     | | || |||| |||  || |  || || |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 .. | |   | || |     |  ||  |                     | | || |||| ||****************  |        |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |   | || |     *****  |                     | | *****|| |||  || ***** || |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |   | || |     |  ||  |                     | | || |||| |||  |***  || || |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |   | || |     ********                     | | **********|  |  **********  |        |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***   | |***                                  ***      |  | |  |           |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                                              |  ***  |           |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        |    ****           ****        ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |  |||||      |   || ||^**||||             |  | || ||||||||      || |||| || |      |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |  |||||      |   || ||   ||||             ^*** || ||||||||      || |||| || |      |  |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | |  |||||      |   || ||   ||||                  || |^***|||      || |||| || |      ^***      
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 .. | |  |||||      *********   ||||                  || |||| |||      || |||| || |                
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 .. | |  |||||          || ||   ||||                  || |||| ||****************| |                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |  |||||          || ||   ||||                  |*****| |||      |*****| || |                
search RasMol script viewer Motif-ligand binding stats  betaturn .. | ****||||          *****   ||||                  ***** ****|      ********** |                
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***   ****                  ||||                          | |              |  |                
search RasMol script viewer Motif-ligand binding stats  nest ..                             ****                          ***              |  |                
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                            ****                

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | |    |  |||  |^**                 |  | || ||||||||  |||| ||  || || |      |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | |    |  |||  |                    ^*** || ||||||||  |||| ||  || || |      |  | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..          | |    |  |||  |                         || |^***|||  |||| ||  || || |      ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..          | |    *********                         || |||| |||  |||| ||  || || |         | |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..          | |    |  |||  |                         || |||| ||****************| |         | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |    *****|  |                         ******| |||  ||*****  || || |         | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | |    |  | |  |                         || |||| |||  |*** ||  || || |         | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |    **** ****                         *****|******** *****  ***** |         | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          ***                                           |  | |  |           |  |         | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                        |  ***  |           |  |         | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        |    ****           ****         ***    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  ||         |  || |||^**||||||           || | || ||||||||   |  |    |  | |       | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  ||         |  || ||||  ||||||           ^*** || ||||||||   |  |    |  | |       | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  ||         |  || ||||  ||||||            | | || |^***|||   |  |    |  | |       ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  ||         *********|  ||||||            | | || |||| |||   |  |    |  | |         |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  ||         |  || || |  ||||||            | | || |||| ||**************** |         |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****         ******** |  |*****            | | ******| |||   |  |    |  | |         |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****          **********  |****             | | **********|   ****    **** |         |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             ||||              ***         | |              ***         |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..                             ****                          ***                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                        ****    

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

21     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |||| |       |  ||||||^**   | |           || |  | |||||| |      || ||| ||| |      | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |||| |       |  |||||||     | |           ^***  | |||||| |      || ||| ||| |      | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | |||| |       |  |||||||     | |            | |  | |^***| |      || ||| ||| |      ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..  | |||| |       *********|     | |            | |  | |||| | |      || ||| ||| |        |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..  | |||| |          |||||||     | |            | |  | |||| | ****************| |        |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****| |          |*****|     | |            | |  *****| | |      |***** ||| |        |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****|| |          *******     | |            | |  ******** |      *********| |        |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | || |                      | |            ***         | |             *** |        |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..    | || |                      ***                        ***              |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..    ******                                                                  ****        ****    

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

22     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || ||| || |   || ||  | |^** |  ||           || |  |  |||||||  ||  || ||||||| | |    | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  || ||| || |   || ||  | |    |  ||           ^***  |  |||||||  ||  || ||||||| | |    | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  || ||| || |   || ||  | |    |  ||            | |  |  ^***|||  ||  || ||||||| | |    ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..  || ||| || |   |*********    |  ||            | |  |  ||| |||  ||  || ||||||| | |      |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..  || ||| || |   |  ||  |      |  ||            | |  |  ||| ||****************| | |      |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****| || |   *****  |      *****            | |  *****| |||  ||  ******|||| | |      |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..  *****| || |   ********      ****             | |  **** ********************| | |      |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | || |                                  ***         | |  |          *** ***      |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***| |                                              ***  |            | |        |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                                                ****            ***        ****    

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

23     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || || |    |  |  |||^**                 || | || ||||||||  |   || |||| || |      | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || || |    |  |  |||                    ^*** || ||||||||  |   || |||| || |      | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  || || |    |  |  |||                     | | || |^***|||  |   || |||| || |      ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  || || |    *********                     | | || ||||||||  |   || |||| || |        |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  || || |       |  ||                      | | || |||||||****************| |        |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  || || |       *****                      | | |*******|||  |   |*****| || |        |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****| || |       ****                       | | **********|  |   ********** |        |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |***                                  ***      |  | |  |           |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***| |                                           |  ***  |           |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                                           |    ****           ****        ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

24     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || |       | || ||||^**||||             || | || |||||| |   |  || |||| ||        | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || |       | || |||||  ||||             ^*** || |||||| |   |  || |||| ||        | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  || |       | || |||||  ||||              | | || |^***| |   |  || |||| ||        ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 ..   |  || |       *********|  ||||              | | || |||| | |   |  || |||| ||          |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 ..   |  || |         || |||||  ||||              | | || |||| | ****************|          |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ***** |         |*******  ||||              | | |*****| | |   |  |*****| ||          |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****| |         *******   ||||              | | ********* |   ************|          |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |                   ||||              ***         | |            |  |          |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                   ****                          ***            |  |          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                          ****          ****    

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

25     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ETS1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11849/searchPTHR11849_SF46PFAM:searchPF00178PIRSF:searchPIRSF001698PRINTS:searchETSDOMAINPROSITE PATTERNS:searchPS00345/searchPS00346, PROSITE PROFILES:searchPS50061, SMART:searchSM00413SUPERFAMILY:searchSSF46785UniProt:searchP14921
sec str:  ...................hhhhhhhhhh..hhh...eee....eee....hhhhhhhhh........hhhhhhhhhh......eee.......eee.
sequence :  ..VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
seq num:  ..10        20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |  || || |    | |||||||^**                 || | || ||||||||  ||  |    |  |  | |    | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |  || || |    | |||||||                    ^*** || ||||||||  ||  |    |  |  | |    | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | |  || || |    | |||||||                     | | || |^***|||  ||  |    |  |  | |    ^*** |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_1 .. | |  || || |    *********                     | | || |||| |||  ||  |    |  |  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  ETS_DOMAIN_2 .. | |  || || |    | |||||||                     | | || |||| ||****************  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |  || || |    ********|                     | | |*****| |||  ||  |    |  |  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn .. | ****| || |    *********                     | | *****|************    ****  | |      |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***   | || |                                  ***      |  | |  |           |  ***      |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***| |                                           |  ***  |           |  |        |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                                           |    ****           ****        ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******                                  

chain B : DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAGCCGGAAGTTCGA
seq num:  ..1         11     

chain C : DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3');
sec str:  ...................
sequence :  ..TCGAACTTCCGGCTCGA
seq num:  ..18        28     

   New search    2stt:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML