triangle PDBeMotif: 2rmh  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification hormone    | release date: Tue, Oct 16, 2007
Title human urocortin 3
Authors C.R.R.GRACE, J.E.RIVIER, J.P.CANTLE, M.H.PERRIN, R.RIEK, W.W.VALE
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |  ***** ******   | *****  | |    
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****  ****  *****    ******   | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                               ***    

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *********** | *****           
search RasMol script viewer Motif-ligand binding stats  betaturn ..        **********  ******            

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****  ***** ***** |     |*****
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****   *************     ***** 

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |********** |  ******    *****
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ***** ****  ********     **** 

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |************                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |***********                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ***                               

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ************ *********         
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ***********  ********          

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ***************|******    *****
search RasMol script viewer Motif-ligand binding stats  betaturn ..       **** ****************     **** 

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ******************       |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       **** ************        ****  

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            ******* || |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ************              

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | ***************|| ||  *****    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | ************** *****  ****     
search RasMol script viewer Motif-ligand binding stats  nest ..   ***                                

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ****** |  |*******|       |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       *******************       **** 

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ********************    | |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       *******************     | **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                               ***    

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |   ********** *********         
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |   *********  ********          
search RasMol script viewer Motif-ligand binding stats  nest ..   ***                                

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ************     *****    *****
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ***********      ****     **** 

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****  |  |*****| |     | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****   ************     | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                               ***    

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****|*****  | ||*****         
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ***********  ********          

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         *************|******  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ***********************      

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |************ | |******  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |***********  ********   ****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ***                               

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |  || ********|******   | ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ********************    ****||
search RasMol script viewer Motif-ligand binding stats  nest ..                                  ****

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UROCORTIN-3
member of: PANTHER:searchPTHR17575/searchPTHR17575_SF1PFAM:searchPF11613UniProt:searchQ969E3
sec str:  ..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
seq num:  ..4         14        24        34      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | **********|             *****  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | ***********             ****   
search RasMol script viewer Motif-ligand binding stats  nest ..   ***                                

   New search    2rmh:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML