triangle PDBeMotif: 2r5g  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transport protein    | release date: Mon, Sep 3, 2007
Title structure of human clic2, crystal form b
Authors B.A.CROMER, G.HANSEN, M.A.GORMAN, M.W.PARKER
Method X-RAY DIFFRACTION (resolution: 1.86Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELK
TDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDP
DSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA
NVAKQKS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CHLORIDE INTRACELLULAR CHANNEL PROTEIN 2
member of: CATH:search1.20.1050.10/search3.40.30.10GENE3D:searchG3DSA_1.20.1050.10/searchG3DSA_3.40.30.10PANTHER:searchPTHR11260/searchPTHR11260_SF133PFAM:searchPF13410/searchPF13417PRINTS:searchINTCLCHANNELPROSITE PROFILES:searchPS50405, SUPERFAMILY:searchSSF47616/searchSSF52833TIGRFAMS:searchTIGR00862UniProt:searchO15247
sec str:  .....eeeeee..........hhhhhhhhhhhhhhh...eeeee...hhhhhh..........eeee..eee..hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh.....ee...ee...............hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh...hhhhhhhhhh.......
sequence :  ..DPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
seq num:  ..11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|          |||||                |||  ^*** | | |       |  |             |  |   |   |  |  | | | |                 |  |||||||                |  | |  |    |  |   | |        |  |                 | |               |  | | | || | |     | |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|          |||||                |||   ||  | ^**       |  |             |  |   |   |  |  | | ^**                 |  |^**|||                |  | |  |    |  |   ^**        |  |                 | |               |  | | | || | |     | |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..*          ^***|                |||   |^*** |         |  |             |  |   |   |  |  | | |                   |  |^***||                |  | |  |    ^***   | |        ^***                 | |               |  | | | ^*** |     | |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..            ||||                |||   |   | |         |  |             |  |   |   |  |  | | |                   |  | || ||                |  | |  |           | |                             | |               |  | | | ||   ******^ |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            ||||                |^*****   | |         |  |             |  |   |   |  |  | | |                   |  | || ||                |  | |  |           | |                             | |               |  | | | ||           |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..            ***|                | |       ***         |  |             |  |   |   |  |  | | |                   |  | || ||                |  | |  |           | |                             | |               |  | | | ||           |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ||||                | |                   ****             ****   |   |  |  | | |                   |  | *****                |  | |  |           | |                             | |               **** | | ||           |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..            ****                ***                   |  |                    |   |  |  | | |                   |  | |                    |  | |  |           | |                             ***               |  | | | ||           |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..                                                      ****                    |   |  **** ***                   ******                    **** ****           ***                                               **** | ****           ****   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                              *****                                                                           | |                                                    *****                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                              ***                                                                            

   New search    2r5g:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors