triangle PDBeMotif: 2r4s  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Fri, Aug 31, 2007
Title crystal structure of the human beta2 adrenoceptor
Authors B.K.KOBILKA, D.M.ROSENBAUM, F.S.THIAN, G.F.SCHERTLER, H.J.CHOI, M.BURGHAMMER, P.C.EDWARDS, R.F.FISCH, R.SANISHVILI, S.G.F.RASMUSSEN, T.S.KOBILKA, V.R.RATNALA, W.I.WEIS
Method X-RAY DIFFRACTION (resolution: 3.40Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGN
FWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAIN
CYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSK
FCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLR
RSSLKAYGNGYSSNGNTGEQSG
Chain L sequence:
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDY
ADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Chain H sequence:
EVQLQQSGAELARPGASVKLSCKASGYIFTDYYINWVRQRTGQGFEWIGEIYPGSGNIDYNERFKDKATLTADKSSSTAY
MQLSSLTSEDSAVYFCVRGFGYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSAVTLGCLVKGYFPEPVTVTWNSGSLS
SGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGC
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BETA-2 ADRENERGIC RECEPTOR
member of: CATH:search1.20.1070.10GENE3D:searchG3DSA_1.20.1070.10PANTHER:searchPTHR24248/searchPTHR24248_SF21PFAM:searchPF00001PRINTS:searchADRENERGICR/searchADRENRGCB2AR/searchGPCRRHODOPSNPROSITE PATTERNS:searchPS00237, PROSITE PROFILES:searchPS50262, SUPERFAMILY:searchSSF81321UniProt:searchP07550
sec str:  ....hhhhhhhhhhhhhhhhhhhhh..hhhhh.hhhhhh...hhhhhh................hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhh...hhhhhh... ..hhhhhhhhhhhhhhhh....hhhhhhhh..........
sequence :  ..GIVMSLIVLAIVFGNVLVITAIA..FERLQTVTNYFITSLACADLVMGLAVVPFG..FWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLT..SSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHV..FCLKEHKALKTLGIIMGTFTLCWLPFFI... ..LNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLK
seq num:  ..37        47        57 ..61        71        81        ..108       118       128       138       148       158    ..203       213       223       233       ..264       274       284     ... ..311       321       331       341     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |||||  | |  ||      .. |  |                         ..  |  || | |||  |  |  ||   || | |   | |            |  ||  ..|  || |  |||  ||     |  | | ||||| || |  ..   |  || || |    |          ..PS00001..                                | ||||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |||||  | |  ||      .. |  |                         ..  |  || | |||  |  |  ||   || | |   | |            |  ||  ..|  || |  |||  ||     |  | | ||||| || |  ..   |  || || |    |          ..PS00004..                                **^*||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |||||  | |  ||      .. |  |                         ..  |  || | |||  |  |  ||   || | |   | |            |  ||  ..|  || |  |||  ||     |  | | ||||| || |  ..   |  || || |    |          ..PS00005..                                  |^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |||||  | |  ||      .. |  |                         ..  ^***| | |||  |  |  ||   || | |   | |            |  ||  ..|  || |  |||  ||     |  | | ||||| || |  ..   |  || || |    |          ..PS00006..                                  | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****||  | |  ||      .. |  |                         ..      | | |||  |  |  ||   || | |   | |            |  ||  ..|  || |  |||  ||     |  | | ||||| || |  ..   |  || || ^*****          ..PS00008..                                  | | 
search RasMol script viewer Motif-ligand binding stats  G_PROTEIN_RECEP_F1_1 ..|  || ||  | |  ||      .. |  |                         ..      | | |***************** | |   | |            |  ||  ..|  || |  |||  ||     |  | | ||||| || |  ..   |  || ||                 ..PS00237..                                  | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..***** ||  | *****      .. |  |                         ..      | | |||  |  *****   |  | |   | |            *****  ..***** **********     |  | | ||||| || |  ..   ********                 ..alphabetamotif..                                  | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..*********** ****       .. |  |                         ..      | | |||  |  ****    |  | |   | |            ****   ..****  **** ****      **** ****|****| |  ..   *******                  ..betaturn..                                  | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       .. |  |                         ..      | | |||  |          |  | |   | |                   ..                            | | | || |  ..                            ..gammaturn..                                  *** 
search RasMol script viewer Motif-ligand binding stats  nest ..                       .. |  |                         ..      | | |||  |          |  | |   | |                   ..                            | | | |***  ..                            ..nest..                                      
search RasMol script viewer Motif-ligand binding stats  niche ..                       .. ****                         ..      | | |||  |          **** |   ***                   ..                            *** ***     ..                            ..niche..                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       ..                              ..      **********             | |                         ..                                        ..                            ..ststaple..                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ..                              ..                             ***                         ..                                        ..                            ..stturn..                                      

chain L : ANTIBODY FOR BETA2 ADRENOCEPTOR, LIGHT CHAIN
member of: CATH:search2.60.40.10
sec str:  .....eeee....ee.....eeeeeee.......eeeeee......eeeee...ee.......eee........eee........eeeeeee......ee...eeeee.........eee..hhhhhhhheeeeeeeeeee......eeeee........eeeee.........eeeeeeeeeehhhhhh..eeeeee........eeeeee....
sequence :  ..DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             |  |    ^**       |      |  |^** || | |  |  ||  | |  | ||     |  ||||||    |            |  |                  |  ||            | |         ^**| ||  || |    | |         | ||||||  | |  ^** | |      | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             ^***      |       |      |  |    || | |  |  ||  | |  ^***     ^***|||||    |            ^***                  |  ||            | |            | ||  ^***    | |         ^***||||  | |   |  | |      | |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..             |  |      ********^      |  |    || | |  |  ||  | |  | |         ||||||    |                                  |  ||            | |            | ||   |      | |           | ||||  | |   |  | |      | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             |  |                     |  |    || | |  |  ||  | ^*****         |||||^*****                                  |  ||            | |            | ^*****      | |           | ||||  | |   |  | |      | |  
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..             |  |                     |  |    || | |  |  ||  |    | |         |||||                                        |  ||            | |            |  |          | |           | ||||  **^****  | |      | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             |  |                     |  |    || | |  |  ||  |    | |         |||||                                        *****            | |            |  |          | |           *****|        |  | |      | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..             |  |                     |  |    || | |  |  ||  |    | |         *****                                        |  |             | |            |  |          | |           | || |        |  | |      | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..             |  |                     |  |    || | |  |  ||  |    | |         ***||                                        |  |             | |            |  |          | |           | || |        |  | |      ***  
search RasMol script viewer Motif-ligand binding stats  betabulge ..             |  |                     |  |    ** | |  |  ||  |    | |         || ||                                        |  |             | |            |  |          | |           | || |        |  | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |                     ****       | |  |  |****    | |         ****|                                        ****             | |            |  |          | |           **** |        **** |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             |  |                     |  |       ***  |  ||  |    ***          |  |                                                         | |            |  |          | |             |  |           | |           
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |                     |  |            |  ||  |                 |  |                                                         | |            |  |          ***             |  |           | |           
search RasMol script viewer Motif-ligand binding stats  niche ..             ****                     ****            ********                 ****                                                         ***            ****                          ****           ***           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                        ***           

chain H : ANTIBODY FOR BETA2 ADRENOCEPTOR, HEAVY CHAIN
member of: CATH:search2.60.40.10
sec str:  .....ee...eeee....eeeeeeee.........eeeeee......eeeeee......eee.hhhh..eeeeee....eeeeeee..hhhhheeeee..........eeeee.........eeee..........eeeeeeeeeee.................eeeeeee.....eeeeeeeeee.........eeeeeehhhheeeeee........
sequence :  ..EVQLQQSGAELARPGASVKLSCKASGYIFTDYYINWVRQRTGQGFEWIGEIYPGSGNIDYNERFKDKATLTADKSSSTAYMQLSSLTSEDSAVYFCVRGFGYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSAVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGC
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      ||||  |  |^** ^**                                      |  |       |  | |        || ||        | | |    |  |^**             | |                       | |||| ||                                   || |^** |      ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ^***  |  |                                             |  |       |  | |        ^***|        | | |    |  | |              | |                       | |||| ||                                   || ||^***      ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |^*****  |                                             |  |       |  | |        || ||        | | ^*****  | |              | |                       | ^*****|                                   || |||         ||||
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      | |   |  |                                             |  |       ******        || ||        | |         | |              | |                       | ||||  |                                   ******         ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |   ****                                             ****          | |        ****|        | |         | |              | |                       ****||  |                                    ****|         ||||
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |                                                                  | |         |  |        | |         | |              ***                         | ||  |                                      | |         ||||
search RasMol script viewer Motif-ligand binding stats  nest ..      ***                                                                  ***         |  |        ***         | |                                          ***|  |                                      ***         ****
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                       ****                    ***                                             ****                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                               ***                                                                                                       

   New search    2r4s:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors