triangle PDBeMotif: 2quk  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   6.1.1.2
Classification ligase    | release date: Mon, Aug 6, 2007
Title crystal structures of human tryptophanyl-trna synthetase in complex with atp(putative)
Authors J.P.DING, N.SHEN
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEA
EEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYT
GRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDY
MGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMT
RDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSF
MYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRYPTOPHANYL-TRNA SYNTHETASE
member of: CATH:search1.10.240.10/search3.40.50.620GENE3D:searchG3DSA_1.10.240.10/searchG3DSA_1.10.287.10/searchG3DSA_3.40.50.620PANTHER:searchPTHR10055/searchPTHR10055_SF1PFAM:searchPF00458/searchPF00579PRINTS:searchTRNASYNTHTRPPROSITE PATTERNS:searchPS00178/searchPS00762, PROSITE PROFILES:searchPS51185, SMART:searchSM00991SUPERFAMILY:searchSSF47060/searchSSF52374TIGRFAMS:searchTIGR00233UniProt:searchP23381
sec str:  ......hhhhhhhhh.ee.hhhhhhhhhhhhh...hhhhhh..eeeeehhhhhhhhhhh...eeeeeee..........hhhhhhhhhhhhhhhh..eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhhh......eeeeehhhhhhhh.hhhhhhhhhhhh.hhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee..hhhhhhhhhhhhhhhh....eeeee..........................hhhhhhhhhhhh.......hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......
sequence :  ..KGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFD
seq num:  ..96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |     | ||| |   |  |   | |  |  |||||  |||| |       | |     | | |      |  | |   |      | |      |  |       |  |  ||  |  |  |  |  |^***  |  |  |    |       |  || |     | ||  | | | ||  |||| ||  |       |  |                    || |||            |  |   | |  | ^***|  || | |    |  | |||  || |       |  |   |  |  | | |     ||  |||||| |||                 || ||     ||  | | ||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  | |     | ||| |   |  |   | |  |  |||||  |||| |       | |     | | |      |  | |   |      | |      |  |       |  |  ||  |  |  |  |  |  |   |  |  |    |       |  || |     | ||  | | | ||  |||| ||  |       |  |                    || |||            |  |   | |  |     |  || | |    |  | |||  || |       |  |   |  |  | | |     ||  |||||| |||                 || ||     ||  | **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*  | |     | ^** |   |  |   | |  |  |||||  ^**| |       | |     ^** |      |  | |   |      | |      |  |       |  |  ||  |  |  |  |  |  |   |  |  |    |       |  || |     | ||  | | | ||  |||| ||  |       |  |                    || |||            |  |   | |  |     |  |^** |    |  | |||  || |       |  |   |  |  | | |     ||  |||||| |||                 || ||     ||  ^**     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |     | |^***   |  |   | |  |  |||||  ^*** |       | |         |      |  | |   |      | |      ^***       |  |  ||  |  |  |  |  |  |   ^***  |    |       |  || |     | |^*** | | ||  |||| ||  |       |  |                    || |||            |  |   | ^***     |  ||   |    |  | |||  ^***       |  |   |  |  | | |     ||  |||||| |||                 || ||     ||  |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |     | |   |   |  |   | |  |  |||^***** | |       | |         |      |  | |   |      | |                 |  |  ||  |  |  |  |  |  |         ^*****       |  || |     | ||  | | | ||  |||| ||  |       |  |                    || |||            |  |   |          |  ||   |    |  | |^*****         |  |   |  |  | | |     ||  ||^*****||                 || ||     ||  |       
search RasMol script viewer Motif-ligand binding stats  AA_TRNA_LIGASE_I ..   | |     | |   |   |  |   | |  |  ||| |     | |       | |         *********** |   |      | |                 |  |  ||  |  |  |  |  |  |                      |  || |     | ||  | | | ||  |||| ||  |       |  |                    || |||            |  |   |          |  ||   |    |  | | |             |  |   |  |  | | |     ||  ||||||  ||                 || ||     ||  |       
search RasMol script viewer Motif-ligand binding stats  WHEP_TRS_1 ..   | |     | |   |   |  |   | |  |  ||| |     | |       | |                |  | |   |      | |                 |  |  ||  |  |  |  |  |  |                      |  || |     | ||  | | | ||  |||| ||  |       |  |                    || |||            |  |   |          |  ||   |    |  | | |             |  |   |  |  | | |     ||  ||||||  ||                 || ||     ||  |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |     | |   |   |  |   | |  *****| |     | |       | |                |  | |   |      | |                 |  *****  |  |  |  |  |  |                      |  || |     | ||  | | | |*****|| ||  |       |  |                    || |||            |  |   |          |  ||   |    |  | | |             |  |   |  |  | | |     ||  |||||*****                 || ||     ||  |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | |     | |   *****  |   | |  |  | | |     | |       | |                |  | |   |      | |                 |  |  |   |  |  |  |  |  |                      |  || |     | ||  | | | ||  | || ||  |       |  |                    || |||            |  |   |          |  ||   |    |  | | |             |  *****  |  | | |     ||  ||||||  |                  || ||     ||  |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ***     | |          |   | |  |  | | |     | |       | |                |  | |   |      | |                 |  |  |   |  |  |  |  |  |                      |  || |     | ||  | | | ||  | || ||  |       |  |                    || |||            |  |   |          |  ||   |    |  | | |             |  |      |  | ***     ||  ||||||  |                  || ||     ||  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |          |   | |  **** | |     | |       | |                **** |   |      | |                 *******   ****  ****  |  |                      |  || |     | |**** | ******* ********       |  |                    |****|            ****   |          ****|   |    |  | | |             |  |      |  | |       ||  |||||****                  ****|     ||  |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |          |   | |       ***     | |       | |                     |   |      | |                                       |  |                      |  || |     | ||  | |   |      |  |          |  |                    |  | |                   |          |  ||   |    |  | | |             |  |      |  | |       ||  |||||                       |  |     ||  |       
search RasMol script viewer Motif-ligand binding stats  nest ..           ***          |   ***               ***       ***                     |   |      ***                                       |  |                      |  || |     ***|  | |   |      |  |          |  |                    |  ***                   |          |  ||   |    |  | | |             |  |      |  | |       ||  |****                       |  |     ||  |       
search RasMol script viewer Motif-ligand binding stats  niche ..                        |   | |                                                 |   |                                                ****                      ****| |        **** |   |      ****          ****                    |    |                   |          ****|   |    **** ***             ****      ******       ||  ||                          ****     |****       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                        |   | |                                                 |   |                                                                              | |             |   |                                            ******                   |              |   |         | |                                    ||  ||                                   |   |       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        |   | |                                                 |   |                                                                              | |             |   |                                                                     |              *****         | |                                    ||  ||                                   |   |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        ***** |                                                 *****                                                                              | |             *****                                                                     |                            | |                                    ******                                   *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ***                                                                                                                                    ***                                                                                       |                            ***                                                                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                             *                                                                                                                        

   New search    2quk:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors