triangle PDBeMotif: 2quh  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   6.1.1.2
Classification ligase    | release date: Sun, Aug 5, 2007
Title crystal structures of human tryptophanyl-trna synthetase in complex with trp
Authors J.P.DING, N.SHEN
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Small molecules:    search TRP TRP binding statistics TRP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEA
EEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYT
GRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDY
MGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMT
RDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSF
MYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRYPTOPHANYL-TRNA SYNTHETASE
member of: CATH:search1.10.240.10/search3.40.50.620GENE3D:searchG3DSA_1.10.240.10/searchG3DSA_1.10.287.10/searchG3DSA_3.40.50.620PANTHER:searchPTHR10055/searchPTHR10055_SF1PFAM:searchPF00458/searchPF00579PRINTS:searchTRNASYNTHTRPPROSITE PATTERNS:searchPS00178/searchPS00762, PROSITE PROFILES:searchPS51185, SMART:searchSM00991SUPERFAMILY:searchSSF47060/searchSSF52374TIGRFAMS:searchTIGR00233UniProt:searchP23381
JMol viewer RasMol script viewer  TRP 817B  ..                                                              *****                              * *  **                                                                                   *                      * *   *   *                                                                                                                                                              
sec str:  ....hhhhhhhhhh.ee.hhhhhhhhhhhhh...hhhhhh..eeeeehhhhhhhhhhh...eeeeeee.......hhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhh.......eeeeehhhhh....hhhhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee..hhhhhhhhhhhhhhh.....eeeee..........................hhhhhhhhhhhhh......hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh.............
sequence :  ..GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQHHHH
seq num:  ..97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       || ||||| |      |   | |  |  |||||| |||| |||     | |     | ||||| | |  ||            | |      |  | |  |            |  |    | |||^***  |  || ||| ||      || |||   |   | || || |   ||  |||| ||| ||   | | | |      |  || ||| |    | |||            |  |  || |  | ^***|  || | | |  |  | |||  || ||     ||| |   || ||||         |   |||||  |                    |  || |  ||  | | |||       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       || ||||| |      |   | |  |  |||||| |||| |||     | |     | ||||| | |  ||            | |      |  | |  |            |  |    | ||||||   |  || ||| ||      || |||   |   | || || |   ||  |||| ||| ||   | | | |      |  || ||| |    | |||            |  |  || |  |  |  |  || | | |  |  | |||  || ||     ||| |   || ||||         |   |||||  |                    |  || |  ||  | **^*|       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       || ||^** |      |   | |  |  |||||| ^**| |||     | |     ^**|||| | |  ||            | |      |  | |  |            |  |    | ||||||   |  || ||| ||      || |||   |   | || || |   ||  |||| ||| ||   | | | |      |  || ||| |    | |||            |  |  || |  |  |  |  |^** | |  |  | |||  || ||     ||| |   || ||||         |   |||||  |                    |  || |  ||  ^** | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       || |||^***      |   | |  |  |||||| ^*** |||     | |        |||| | |  ||            | |      ^*** |  |            |  |    | ||||||   ^***| ||| ||      || |||   |   | |^*** |   ||  |||| ||| ||   | | | |      |  || ||| |    | |||            |  |  || ^***  |  |  || | | |  |  | |||  ^***|     ||| |   || ||||         |   |||||  |                    |  || |  ||  |   | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       || |||          |   | |  |  |||^***** | |||     | |        |||| | |  ||            | |           |  |            |  |    | ||||||       | ^*****      || |||   |   | || || |   ||  |||| ||| ||   | | | |      |  || ||| |    | |||            |  |  ||    |  |  |  || | | |  |  | |^*****  |     ||| |   || ||||         |   ||^*****                    |  || |  ||  |   | |       
search RasMol script viewer Motif-ligand binding stats  AA_TRNA_LIGASE_I ..       || |||          |   | |  |  ||||||    | |||     | |        |***********            | |           |  |            |  |    | ||||||       |  || |       || |||   |   | || || |   ||  |||| ||| ||   | | | |      |  || ||| |    | |||            |  |  ||    |  |  |  || | | |  |  | | |  |   |     ||| |   || ||||         |   |||||                       |  || |  ||  |   | |       
search RasMol script viewer Motif-ligand binding stats  WHEP_TRS_1 ..       || |||          |   | |  |  ||||||    | |||     | |        | || | |  |             | |           |  |            |  |    | ||||||       |  || |       || |||   |   | || || |   ||  |||| ||| ||   | | | |      |  || ||| |    | |||            |  |  ||    |  |  |  || | | |  |  | | |  |   |     ||| |   || ||||         |   |||||                       |  || |  ||  |   | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       || |||          |   | |  *****||||    *****     | |        | || | |  |             | |           |  |            |  |    | |*****       |  || |       || |||   |   | || || |   |*****|| ||| ||   | | | |      |  |***** |    | |||            |  |  ||    |  |  |  || | | |  |  | | |  |   |     ||| |   |*****|         |   |||||                       |  || |  ||  |   | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       || |||          |   | |  |  | ||||    | ||      | |        | || | |  |             | |           |  |            |  |    | |*****       |  || |       || |||   |   | || || |   ||  | || ||| ||   | | | |      |  || ||  |    | |||            |  |  ||    |  |  |  || | | |  |  | | |  |   |     ||| *****| || |         |   |||||                       |  || |  ||  |   | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..       || |||          |   | |  |  | ||||    | ||      | |        | || | |  |             | |           |  |            |  |    | |***||       |  || |       || |||   |   | || || |   ||  | || ||| ||   | | | |      |  || ||  |    | |||            |  |  ||    |  |  |  || | | |  |  | | |  |   |     *** |    | || |         |   |||||                       |  || |  ||  |   | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |****|          |   | |  **** ||||    ****      | |        | || | ****             | |           |  |            ****    | |****|       ****| |       ****||   |   | || || |   |**** *********   | | | |      ********  |    ****|            ****  ||    ****  |  || | | |  |  | | |  |   |      |  |    **** |         |   |||||                       |  || |  ||  |   | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |  | |          |   | |       ||||    | |       | |        ***| |                  | |           |  |                    | | |  |           | |        |  ||   |   | || || |   |      |  |       | | | |            |   |      | |               |  ||          |  || | | |  |  | | |  |   |      |  |      |  |         |   |||||                       |  || |  ||  |   ***       
search RasMol script viewer Motif-ligand binding stats  nest ..       |  ***          |   ***       ****    ***       ***           | |                  ***           |  |                    *** |  |           | |        |  ||   |   ***| || |   |      |  |       *** | |            |   |      ***               |  ||          |  || | | |  |  | | |  |   |      |  |      |  |         |   |****                       |  || |  ||  |             
search RasMol script viewer Motif-ligand binding stats  niche ..       |    |          |   | |        ***                            ***                                ****                        ****           | |        ****|   |      **** |   |      ****           ***            |   |                        ****|          ****| | | |  **** ***  |   |      ****      ****         |   | ***                       ****| |  |****             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..       ******          |   | |                                       | |                                                                           | |            |   |      | |  |   |                                    |   |                            |              | | | |       | |  |   |                             |   |                               | |  |   |             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                       |   | |                                       | |                                                                           | |            *****      | |  |   |                                    |   |                            |              ***** |       | |  *****                             |   |                               | |  |   |             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       ***** |                                       | |                                                                           | |                       | |  *****                                    *****                            |                *****       | |                                    *****                               | |  *****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                           ***                                       ***                                                                           ***                       ***                                                                            |                            ***                                                                        ***                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                            *                                                                                                                              

chain B : TRYPTOPHANYL-TRNA SYNTHETASE
member of: CATH:search1.10.240.10/search3.40.50.620GENE3D:searchG3DSA_1.10.240.10/searchG3DSA_1.10.287.10/searchG3DSA_3.40.50.620PANTHER:searchPTHR10055/searchPTHR10055_SF1PFAM:searchPF00458/searchPF00579PRINTS:searchTRNASYNTHTRPPROSITE PATTERNS:searchPS00178/searchPS00762, PROSITE PROFILES:searchPS51185, SMART:searchSM00991SUPERFAMILY:searchSSF47060/searchSSF52374TIGRFAMS:searchTIGR00233UniProt:searchP23381
JMol viewer RasMol script viewer  TRP 818B  ..                                                                   *****                              * *  *                                                                                    *                      * *   *   *                                                                                                                                                           
sec str:  .........hhhhhhhhhh.ee.hhhhhhhhhhhhh...hhhhhh....eeehhhhhhhhhhh...eeeeeee.......hhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhh.......eeeeehhhhhhhh.hhhhhhhhhhhh.hhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee..hhhhhhhhhhhhhhh.....eeeee...ee..eeeee..............hhhhhhhhhhhhh......hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........
sequence :  ..TSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQH
seq num:  ..92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |  | |  || ||||| |   |  |   | |       |||| |||| |       | |     | | | | |     |            | |      |  | |  |                 |  | |||^***  |  || ||   |      || |||   |   | || ||      |  |||| ||  ||  ||   | |      |  |  |   |   || |||               |  || |  ||^***|  || |      |  | |||| || ||      |  |   |  |  |              ||||  |     |  ||         || ||     ||  | | ||  | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  | |  | |  || ||||| |   |  |   | |       |||| |||| |       | |     | | | | |     |            | |      |  | |  |                 |  | ||||||   |  || ||   |      || |||   |   | || ||      |  |||| ||  ||  ||   | |      |  |  |   |   || |||               |  || |  || || |  || |      |  | |||| || ||      |  |   |  |  |              ||||  |     |  ||         || ||     ||  | **^*  | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ^**  | |  || ||^** |   |  |   | |       |||| ^**| |       | |     ^** | | |     |            | |      |  | |  |                 |  | ||||||   |  || ||   |      || |||   |   | || ||      |  |||| ||  ||  ||   | |      |  |  |   |   || |||               |  || |  || || |  |^**      |  | |||| || ||      |  |   |  |  |              ||||  |     |  ||         || ||     ||  ^**     | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |  || |||^***   |  |   | |       |||| ^*** |       | |         | | |     |            | |      ^*** |  |                 |  | ||||||   ^***| ||   |      || |||   |   | |^***      |  |||| ||  ||  ||   | |      |  |  |   |   || |||               |  || ^***| || |  |         |  | |||| ^***|      |  |   |  |  |              ||||  |     |  ||         || ||     ||  |       | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |  || |||   |   |  |   | |       |^***** | |       | |         | | |     |            | |           |  |                 |  | ||||||       | ^*****      || |||   |   | || ||      |  |||| ||  ||  ||   | |      |  |  |   |   || |||               |  ||    || || |  |         |  | |^*****  |      |  |   |  |  |              |^*****     |  ||         || ||     ||  |       | |
search RasMol script viewer Motif-ligand binding stats  AA_TRNA_LIGASE_I ..       | |  || |||   |   |  |   | |       ||||    | |       | |         ***********            | |           |  |                 |  | ||||||       |  |          || |||   |   | || ||      |  |||| ||  ||  ||   | |      |  |  |   |   || |||               |  ||    || || |  |         |  | | || |   |      |  |   |  |  |              ||||        |  ||         || ||     ||  |       | |
search RasMol script viewer Motif-ligand binding stats  WHEP_TRS_1 ..       | |  || |||   |   |  |   | |       ||||    | |       | |           | |                  | |           |  |                 |  | ||||||       |  |          || |||   |   | || ||      |  |||| ||  ||  ||   | |      |  |  |   |   || |||               |  ||    || || |  |         |  | | || |   |      |  |   |  |  |              ||||        |  ||         || ||     ||  |       | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |  || |||   |   |  |   | |       ||||    | |       | |           | |                  | |           |  |                 |  | ||||||       |  |          || |||   |   | || ||      *****|| ||  |*****   | |      |  |  |   |   || |||               |  ||    || || |  |         |  | | || |   |      |  |   |  |  |              ||||        *****         || ||     ||  |       | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |  || |||   *****  |   | |       ||||    | |       | |           | |                  | |           |  |                 |  | |*****       |  |          || |||   |   | || ||      |  | || ||  ||  |    | |      |  |  |   |   || |||               |  ||    || || |  |         |  | | || |   |      |  *****  |  |              ||||        |  |          || ||     ||  |       | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ***  || |||          |   | |       ||||    | |       | |           | |                  | |           |  |                 |  | |***||       |  |          || |||   |   | || ||      |  | || ||  ||  |    | |      |  |  |   |   || |||               |  ||    || || |  |         |  | | || |   |      |  |      |  |              ||||        |  |          || ||     ||  |       | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |****|          |   | |       ||||    | |       | |           | |                  | |           |  |                 **** |****|       ****          ****||   |   | || ||      **** ************    | |      ****  |   |   *****|               ****|    ****| ****         |  | | || |   |      |  |      |  |              ||||        ****          ****|     |****       | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |  | |          |   | |       ||||    | |       | |           | |                  | |           |  |                    | | |  |                      |  ||   |   | || ||            |  |           | |            |   |      | |               |  ||     |  | |  |         |  | | || |   |      |  |      |  |              ||||                       |  |     ||  |       ***
search RasMol script viewer Motif-ligand binding stats  nest ..            |  ***          |   ***       ****    ***       ***           | |                  ***           |  |                    *** |  |                      |  ||   |   ***| ||            |  |           | |            |   |      ***               |  ||     |  | |  |         |  | | || |   |      |  |      |  |              ****                       |  |     ||  |          
search RasMol script viewer Motif-ligand binding stats  niche ..            |    |          |   |          ***                            ***                                ****                        ****                      ****|   |      ****            ****           ***            |   |                        ****|     **** ****         **** ******   |      ****      ****                                         ****     |****          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            ******          |   |                                                                                                                                      |   |      | |                                           |   |                            |                            | |  |   |                                                                      |   |          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                            |   |                                                                                                                                      *****      | |                                           |   |                            |                            | |  *****                                                                      |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            *****                                                                                                                                                 | |                                           *****                            |                            | |                                                                             *****          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                  ***                                                                            |                            ***                                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                 *                                                                                                                           

   New search    2quh:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors