triangle PDBeMotif: 2qa7  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification actin binding    | release date: Thu, Jun 14, 2007
Title crystal structure of huntingtin-interacting protein 1 (hip1) coiled-coil domain with a basic surface suitable for hip-protein interactor (hippi)
Authors J.A.YBE, Q.NIU
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
GSKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDT
EKAQRSLSEIERKAQANEQRYSKLKEKYSELVQN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HUNTINGTIN-INTERACTING PROTEIN 1
member of: PANTHER:searchPTHR10407/searchPTHR10407_SF14UniProt:searchO00291
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh...
sequence :  ..DEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYS
seq num:  ..371       381       391       401       411       421       431       441       451       461      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| ||                      ^**         |  |             |  ||               ^** |||  | |   |  |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..** ||                                  ^***             |  ||                |  ||^*** |   |  |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..*****                                                   *****                *****     *****  |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..****                                                    ****                 ****             **** 

chain B : HUNTINGTIN-INTERACTING PROTEIN 1
member of: PANTHER:searchPTHR10407/searchPTHR10407_SF14UniProt:searchO00291
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..DEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDEL
seq num:  ..371       381       391       401       411       421       431       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |                         ^**         |  ||  ||          |  ||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**                                     ^***|  ||          |  ||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                           *****          *****       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                           ****           ****        

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : HUNTINGTIN-INTERACTING PROTEIN 1
member of: PANTHER:searchPTHR10407/searchPTHR10407_SF14UniProt:searchO00291
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..DEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYSKLK
seq num:  ..371       381       391       401       411       421       431       441       451       461         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |                         ^**         |  |                                 ^**   |  | |  || |||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**                                     ^***                                       ^*** |  || |||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                                                                       *********      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                                                                       ********       

chain D : HUNTINGTIN-INTERACTING PROTEIN 1
member of: PANTHER:searchPTHR10407/searchPTHR10407_SF14UniProt:searchO00291
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..DEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDEL
seq num:  ..371       381       391       401       411       421       431       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|||                  |   | ^**     ||  || |                           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**|                  |   |         ||  ^***                           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |                  |   |         |*****                             
search RasMol script viewer Motif-ligand binding stats  asxturn ..***                  |   |         ||  |                              
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     |   |         |****                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     *****         *****                              

   New search    2qa7:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors