triangle PDBeMotif: 2q53  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification structural genomics, unknown function    | release date: Thu, May 31, 2007
Title ensemble refinement of the crystal structure of uncharacteri protein loc79017 from homo sapiens
Authors CENT, D.A.KONDRASHOV, E.J.LEVIN, EUKARYOTIC STRUCTURAL GENOMICS (CESG), G.E.WESENBERG, G.N.PHILLIPS JR.
Method X-RAY DIFFRACTION (resolution: 2.01Å)
PDBe Citation   
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVW
GVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKL
KAIEPNDYTGKVSEEIEDIIKKGETQTL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UNCHARACTERIZED PROTEIN C7ORF24
member of: CATH:search3.10.490.10GENE3D:searchG3DSA_3.10.490.10PANTHER:searchPTHR12935PFAM:searchPF13772SUPERFAMILY:searchSSF110857UniProt:searchO75223
sec str:  ....eeeeee.hhhhhhhhhhhhh...eeeeeeeeeeeeeeeeee...........eeeeeeeeeeeeeeeeeeee..hhhhhhhhh.......eeeeeeee.....eeeeeeee...eee...hhhhhhhhhhhhhhh..hhhhhhhhhh..........hhhhhhhhhh
sequence :  ..EESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKK
seq num:  ..14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         || ||| |  | |  |  ||   |  |    | |  | | || |    |  |  |         ^***| | || ||||||||        | |||  | |    |  |    |   |  |  ||  |||       || |    || | |  ||     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         || ||^**  | |  |  ||   |  |    | |  | | || |    |  |  |         ||||| | || ||||||||        | |||  ^**    |  |    |   |  |  ||  |||       || |    |^** |  ||     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         || ||  |  | |  |  ||   |  |    | |  | | || |    |  ^***         ||||| ^*** ||||||||        | |||         ^***    |   |  |  ||  |||       || |    |    |  ||     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         || ||  |  | |  |  ||   |  |    | |  | | || |    |               |||||   |  ||||||||        | |||                 |   |  |  ||  |||       |*******^    |  ||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         || ||  |  | |  |  ||   |  |    ^***** | || ^*****               |||||   |  |^*****|        | |||                 |   |  |  ^*****|       |  |         |  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         || ||  |  | |  |  ||   |  |      |  | | || |                    |||||   |  ||||||||        | |||                 |   |  *****  | |       |  |         *****     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         || ||  |  | |  |  ||   |  |      |  | | || |                    *****   |  ||||||||        | |||                 |   |  |  |   | |       |  |         |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..         || ||  |  | |  |  ||   |  |      |  | | || |                    ***||   |  ||||||||        | |||                 |   |  |  |   | |       |  |         |  |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..         || ||  |  | |  |  **   |  |      |  | | || |                    || ||   |  ||||||||        | |||                 |   |  |  |   | |       |  |         |  |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         || ||  |  | |  |       |  |      |  | | || |                    || ||   |  ||||||||        *****                 |   |  |  |   | |       |  |         |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|  **** |  |       |  |      **** | || |                    *****   ****|||||||        ****|                 |   |  ****   | |       |  |         ****      
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |       |  |       |  |           | |***                               ********        | ***                 |   |         ***       |  |                   
search RasMol script viewer Motif-ligand binding stats  niche ..          ****       ****       ****           | |                                                  | | |                 |   |                   ****                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                               | |                                                  *****                 *****                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                  ***                                                                  

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UNCHARACTERIZED PROTEIN C7ORF24
member of: CATH:search3.10.490.10GENE3D:searchG3DSA_3.10.490.10PANTHER:searchPTHR12935PFAM:searchPF13772SUPERFAMILY:searchSSF110857UniProt:searchO75223
sec str:  ....eeeeee.hhhhhhhhhhhhh...eeeeeeeeeeeeeeeeee...........eeeeeeeeeeeeeeeeeeee..hhhhhhhhh.......eeeeeeee.....eeeeeeee...eee...hhhhhhhhhhhhhhh..hhhhhhhhhh..........hhhhhhhhhh
sequence :  ..EESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKK
seq num:  ..14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          |  || ||   |  |  ||   |  |    ||  ||    | |    |  |  |         ^***  |  | ||||||||        | | |  | |    |  |    |   |     ||| |||       || |  | || |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |^**|   |  |  ||   |  |    ||  ||    | |    |  |  |         | |   |  | ||||||||        | | |  ^**    |  |    |   |     ||| |||       || |  | |^**           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |  ||   |  |  ||   |  |    ||  ||    | |    |  ^***         | |   ^*** ||||||||        | | |         ^***    |   |     ||| |||       || |  | |              
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          |  |  ||   |  |  ||   |  |    ||  ||    | |    |  |  |         | |        ||||||||        | | |                 |   |     ||| |||       |*******^              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |  ||   |  |  ||   |  |    ^*****    | ^*****  |  |         | |        |^*****|        | | |                 |   |     ^*****|       |  |  | |              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  *****   |  |  ||   |  |     |  |     | |       |  |         | |        ||||||||        | | |                 |   |      || |||       |  |  | |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |  |    |  |  ||   |  |     |  |     | |       |  |         ***        ||||||||        | | |                 |   |      || |||       |  |  | |              
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |  |    |  |  **   |  |     |  |     | |       |  |                    ||||||||        | | |                 |   |      || |||       |  |  | |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  ****    |  |       |  |     ****     | |       ****                    ||****||        | | |                 |   |      |****|       |  |  | |              
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |       |  |       |  |              ***       |  |                    ********        | ***                 |   |      |  ***       |  |  | |              
search RasMol script viewer Motif-ligand binding stats  niche ..          ****       ****       ****                        ****                     |    |         | |                   |   |      |    |       ****  ***              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                     ******         | |                   |   |      ******                              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                    | |                   *****                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    ***                                                                  

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UNCHARACTERIZED PROTEIN C7ORF24
member of: CATH:search3.10.490.10GENE3D:searchG3DSA_3.10.490.10PANTHER:searchPTHR12935PFAM:searchPF13772SUPERFAMILY:searchSSF110857UniProt:searchO75223
sec str:  ....eeeeee.hhhhhhhhhhhhh...eeeeeeeeeeeeeeeeee...........eeeeeeeeeeeeeeeeeeee..hhhhhhhhh.......eeeeeeee.....eeeeeeee...eee...hhhhhhhhhhhhhhh..hhhhhhhhhh..........hhhhhhhhhh
sequence :  ..EESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKK
seq num:  ..14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          |  || |    |  |  ||   |  |    |    | |  |||    |  |  |         ^***| |  | ||||||||        | |||  | |    |  |    |   |     |   |||    |  || |  | || |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |^**    |  |  ||   |  |    |    | |  |||    |  |  |         ||| | |  | ||||||||        | |||  ^**    |  |    |   |     |   |||    |  || |  | |^**           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |       |  |  ||   |  |    |    | |  |||    |  ^***         ||| | ^*** ||||||||        | |||         ^***    |   |     |   |||    |  || |  | |              
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          |  |       |  |  ||   |  |    |    | |  |||    |  |  |         ||| |    | ||||||||        | |||                 |   |     |   |||    |  |*******^              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |       |  |  ||   |  |    ^***** |  ||^*****  |  |         ||| |    | |^*****|        | |||                 |   |     ^*****|    |  || |  | |              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |       |  |  ||   |  |           |  |||       |  |         ||| |    | ||||||||        | |||                 |   |         | |    ***** |  | |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |       |  |  ||   |  |           |  |||       |  |         *** |    | ||||||||        | |||                 |   |         | |    |  |  |  ***              
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |       |  |  **   |  |           |  |||       |  |          |  |    | ||||||||        | |||                 |   |         | |    |  |  |  | |              
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          |  |       |  |       |  |           |  |||       |  |          |  |    | ||||||||        *****                 |   |         | |    |  |  |  | |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |       |  |       |  |           |  |||       ****          ****    ********||        ****|                 |   |         | |    ****  |  | |              
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |       |  |       |  |           |  ***       |  |                    ********        | ***                 |   |         ***       |  |  | |              
search RasMol script viewer Motif-ligand binding stats  niche ..          ****       ****       ****           |   |        ****                                    | | |                 |   |                   ****  ***              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                               *****                                                *****                 *****                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    ***                                                                  

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UNCHARACTERIZED PROTEIN C7ORF24
member of: CATH:search3.10.490.10GENE3D:searchG3DSA_3.10.490.10PANTHER:searchPTHR12935PFAM:searchPF13772SUPERFAMILY:searchSSF110857UniProt:searchO75223
sec str:  ....eeeeee.hhhhhhhhhhhhh...eeeeeeeeeeeeeeeeee...........eeeeeeeeeeeeeeeeeeee..hhhhhhhhh.......eeeeeeee.....eeeeeeee...eee...hhhhhhhhhhhhhhh..hhhhhhhhhh..........hhhhhhhhhh
sequence :  ..EESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKK
seq num:  ..14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          |  || |    |  |       |  |    ||  || | || |    |  |  |         ^***| |  | ||||||||        | |||  | |    |  |      |  ||   |   |||       || |  | || | |   |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |^**    |  |       |  |    ||  || | || |    |  |  |         | ||| |  | ||||||||        | |||  ^**    |  |      |  ||   |   |||       || |  | |^** |   |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |       |  |       |  |    ||  || | || |    |  ^***         | ||| ^*** ||||||||        | |||         ^***      |  ||   |   |||       || |  | |    |   |     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          |  |       |  |       |  |    ||  || | || |    |  |  |         | |||    | ||||||||        | |||                   |  ||   |   |||       |*******^    |   |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |       |  |       |  |    ^***** | || ^*****  |  |         | |||    | |^*****|        | |||                   |  ||   ^*****|       |  |  | |    |   |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |       |  |       |  |     |  |  | || |       |  |         | |||    | ||||||||        | |||                   *****       | |       |  |  | |    |   |     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  |       |  |       |  |     |  |  | || |       |  |         *****    | ||||||||        | |||                   |  |        | |       |  |  | |    |   |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |       |  |       |  |     |  |  | || |       |  |         ***|     | ||||||||        | |||                   |  |        | |       |  |  ***    |   |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          |  |       |  |       |  |     |  |  | || |       |  |         |  |     | ||||||||        *****                   |  |        | |       |  |  | |    |   |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |       |  |       |  |     ****  | || |       |  |         ****     *******|||        ****|                   ****        | |       |  |  | |    |   |     
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |       |  |       |  |           | |***       |  |                    ********        | ***                               ***       |  |  | |    |   |     
search RasMol script viewer Motif-ligand binding stats  niche ..          ****       ****       ****           | |          ****                                    | | |                                         ****  ***    |   |     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                               | |                                                  *****                                                      *****     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                  ***                                                                  

Assembly 2  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : UNCHARACTERIZED PROTEIN C7ORF24
member of: CATH:search3.10.490.10GENE3D:searchG3DSA_3.10.490.10PANTHER:searchPTHR12935PFAM:searchPF13772SUPERFAMILY:searchSSF110857UniProt:searchO75223
sec str:  ...eeeeee.hhhhhhhhhh......eeeeeeeeeeeeeeeeee...........eeeeeeeeeeeeeeeeeeee..hhhhhhhhh.......eeeeeeee.....eeeeeeee...eee...hhhhhhhhhhhhhhh..hhhhhhhhhhh.........hhhhhhhhh..
sequence :  ..ESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKG
seq num:  ..15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         |  || |    |  |       |  |    | |  |    | |    |  |  |         ^***  |  | ||||||||        | |||  | |    |  |              |   |||   |  ||| |  | || | |   |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |^**    |  |       |  |    | |  |    | |    |  |  |         |  |  |  | ||||||||        | |||  ^**    |  |              |   |||   |  ||| |  | |^** |   |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |       |  |       |  |    | |  |    | |    |  ^***         |  |  ^*** ||||||||        | |||         ^***              |   |||   |  ||| |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         |  |       |  |       |  |    | |  |    | |    |  |  |         |  |       ||||||||        | |||                           |   |||   |  ||*******^    |   |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |       |  |       |  |    ^*****    | ^*****  |  |         |  |       |^*****|        | |||                           ^*****|   |  ||  |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |       |  |       |  |      |  |    | |       |  |         |  |       ||||||||        | |||                               | |   *****  |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |       |  |       |  |      |  |    | |       |  |         |  |       ||||||||        | |||                               | |   |  ||  |  ***    |   |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  |       |  |       |  |      |  |    | |       |  |         |  |       ||||||||        *****                               | |   |  ||  |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |       |  |       |  |      ****    | |       ****         ****       ||||||||        ****|                               | |   ****|  |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |       |  |       |  |              ***       |  |                    ********        | ***                               ***       |  |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..         ****       ****       ****                        ****                                    | | |                                         ****  ***    |   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                   *****                                                      *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                   ***                                                                   

Assembly 2  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : UNCHARACTERIZED PROTEIN C7ORF24
member of: CATH:search3.10.490.10GENE3D:searchG3DSA_3.10.490.10PANTHER:searchPTHR12935PFAM:searchPF13772SUPERFAMILY:searchSSF110857UniProt:searchO75223
sec str:  ...eeeeee.hhhhhhhhhh......eeeeeeeeeeeeeeeeee...........eeeeeeeeeeeeeeeeeeee..hhhhhhhhh.......eeeeeeee.....eeeeeeee...eee...hhhhhhhhhhhhhhh..hhhhhhhhhhh.........hhhhhhhhh..
sequence :  ..ESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKG
seq num:  ..15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         |  || ||   |  |       |  |    ||| || | || |    |  |  |         ^***  || | ||||||||        | | |  | |    |  |    |   |     |   ||||  ||  || |  | || | |   |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |^**|   |  |       |  |    ||| || | || |    |  |  |            |  || | ||||||||        | | |  ^**    |  |    |   |     |   ||||  ||  || |  | |^** |   |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |  ||   |  |       |  |    ||| || | || |    |  ^***            |  ^*** ||||||||        | | |         ^***    |   |     |   ||||  ||  || |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         |  |  ||   |  |       |  |    ||| || | || |    |  |  |            |  ||   ||||||||        | | |                 |   |     |   ||||  ||  |*******^    |   |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |  ||   |  |       |  |    ^***** | || ^*****  |  |            |  ||   |^*****|        | | |                 |   |     ^*****||  ||  |  |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  *****   |  |       |  |     || || | || |       |  |            *****   ||||||||        | | |                 |   |         | |*****  |  |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..         *******    |  |       |  |     ***** | || |       |  |            ****    ||****||        | | |                 |   |         | |****   |  |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |       |  |       |  |           | |***       |  |                    ********        | ***                 |   |         ***       |  |  | |    |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..         ****       ****       ****           | |          ****                     |    |         | |                   |   |                   ****  ***    |   |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                              | |                                   ******         | |                   |   |                                |   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              | |                                                  | |                   *****                                *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                              ***                                                  ***                                                                   

Assembly 2  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : UNCHARACTERIZED PROTEIN C7ORF24
member of: CATH:search3.10.490.10GENE3D:searchG3DSA_3.10.490.10PANTHER:searchPTHR12935PFAM:searchPF13772SUPERFAMILY:searchSSF110857UniProt:searchO75223
sec str:  ...eeeeee.hhhhhhhhhh......eeeeeeeeeeeeeeeeee...........eeeeeeeeeeeeeeeeeeee..hhhhhhhhh.......eeeeeeee.....eeeeeeee...eee...hhhhhhhhhhhhhhh..hhhhhhhhhhh.........hhhhhhhhh..
sequence :  ..ESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKG
seq num:  ..15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         |  || |    |  |               ||  || | || |    |  |  |         ^***  |  | ||||||||        | |||  | |    |  |    |   |     |   |||       || |    || | |   |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |^**    |  |               ||  || | || |    |  |  |         |  |  |  | ||||||||        | |||  ^**    |  |    |   |     |   |||       || |    |^** |   |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |       |  |               ||  || | || |    |  ^***         |  |  ^*** ||||||||        | |||         ^***    |   |     |   |||       || |    |    |   |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         |  |       |  |               ||  || | || |    |               |  |     | ||||||||        | |||                 |   |     |   |||       |*******^    |   |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |       |  |               ^***** | || ^*****               |  |     | |^*****|        | |||                 |   |     ^*****|       |  |         |   |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  |       |  |                |  |  | || |                    |  |     | ||||||||        *****                 |   |         | |       |  |         |   |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |       |  |                ****  | || |                    ****     ****||||||        ****|                 |   |         | |       |  |         |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |       |  |                      | |***                               ********          ***                 |   |         ***       |  |         |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..         ****       ****                      | |                                                                        |   |                   ****         |   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              | |                                                                        *****                                *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                              ***                                                                                                                        

Assembly 2  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : UNCHARACTERIZED PROTEIN C7ORF24
member of: CATH:search3.10.490.10GENE3D:searchG3DSA_3.10.490.10PANTHER:searchPTHR12935PFAM:searchPF13772SUPERFAMILY:searchSSF110857UniProt:searchO75223
sec str:  ...eeeeee.hhhhhhhhhh......eeeeeeeeeeeeeeeeee...........eeeeeeeeeeeeeeeeeeee..hhhhhhhhh.......eeeeeeee.....eeeeeeee...eee...hhhhhhhhhhhhhhh..hhhhhhhhhhh.........hhhhhhhhh..
sequence :  ..ESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKG
seq num:  ..15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         |  || |  | |  |  ||   |  |    | |  | | || |    |  |  |         ^***| |||| ||||||||        | |||  | |    |  |              ||| |||       || |  | || | |  ||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |^**  | |  |  ||   |  |    | |  | | || |    |  |  |         || || |||| ||||||||        | |||  ^**    |  |              ||| |||       || |  | |^** |  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |  |  | |  |  ||   |  |    | |  | | || |    |  ^***         || || ^*** ||||||||        | |||         ^***              ||| |||       || |  | |    |  ||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         |  |  |  | |  |  ||   |  |    | |  | | || |    |  |  |         || ||  ||  ||||||||        | |||                           ||| |||       |*******^    |  ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |  |  | |  |  ||   |  |    ^***** | || ^*****  |  |         || ||  ||  |^*****|        | |||                           ^*****|       |  |  | |    |  ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |  |  | |  |  ||   |  |      |  | | || |       |  |         || |*****  ||||||||        | |||                            || |||       |  |  | |    *****      
search RasMol script viewer Motif-ligand binding stats  betabulge ..         |  |  |  | |  |  **   |  |      |  | | || |       |  |         || ||  |   ||||||||        | |||                            || |||       |  |  | |    |  |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  |  |  | |  |       |  |      |  | | || |       |  |         || ||  |   ||||||||        *****                            || |||       |  |  | |    |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |  **** ****       |  |      **** | || |       ****         ********   ||****||        ****|                            |****|       |  |  | |    ****       
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |       |  |       |  |           | |***       |  |                    ********        | ***                            |  ***       |  |  | |               
search RasMol script viewer Motif-ligand binding stats  niche ..         ****       ****       ****           | |          ****                                    | | |                            |    |       ****  ***               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                              | |                                                  | | |                            ******                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              | |                                                  *****                                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                              ***                                                  ***                                                                   

   New search    2q53:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors