triangle PDBeMotif: 2prf  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification actin-binding    | release date: Wed, Jan 12, 1994
Title three dimensional solution structure of acanthamoeba profilin i
Authors D.A.TORCHIA, E.E.LATTMAN, S.J.ARCHER, T.D.POLLARD, V.K.VINSON
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGK
KGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| || ||               |    |             |    |   | |    |  |       | |      | **^*|   | || |       |  || |||  |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || ||               |    |             |    |   | |    |  |       ^**      |  ||||   ^**^**       |  || |||  |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |^***               |    |             |    |   | |    ^***         |      |  ||||                |  || |||  |             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| |  ||               |    |             |    |   | |                 *******^  ||||                |  || |||  |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |  ||               ^*****             ^*****   | |                        |  ||||                |  || ^*****             
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..| |  ||                                           | |                        ^***|||                |  ||  ||                
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                                           | |                           ||||                |  ||  ||                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |                                            | |                           ||||                |  |*****                
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****                                            | |                           ||||                |  |****                 
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  ***                           ****                |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                                    ****                     

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  |               |    |             |  | ||| |      |  |       | |      | **^*    | || |        | |  | |  |  |  ||   | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |               |    |             |  | ||| |      |  |       ^**      |  |      ^**^**        | |  | |  |  |  ||   | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***               |    |             |  | ||| |      ^***         |      |  |                    | |  | |  |  |  ||   | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|     |               |    |             |  | ||| |                   *******^  |                    | |  | |  |  |  ||   | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|     |               ^*****             ^*****|| |                          |  |                    | |  ^*****  |  ||   | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|     |                                     |  || |                          ^***                    | |  | |     |  ||   | |
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                                     |  || |                                                  | |  | |     |  ||   | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                            ***** |                                                  | |  | |     *****   | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                            ****  |                                                  | |  | |     ****    | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                               |  |                                                  ***  ***             ***
search RasMol script viewer Motif-ligand binding stats  niche ..                                               ****                                                                          

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| || ||               | | ||             |  | ||  | |  | |  || |    | |      | **^*    | || |             |    |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || ||               | | ||             |  | ||  | |  | |  || |    ^**      |  |      ^**^**             |    |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |^***               | | ||             |  | ||  | |  | ^***| |      |      |  |         | |             |    |             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| |  ||               | | ||             |  | ||  | |  |     | |      *******^  |         | |             |    |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |  ||               ^*****             ^*****|  | |  |     | |             |  |         | |             ^*****             
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..| |  ||                 | |                 |  |  | |  |     | |             ^***         | |                                
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                 | |                 |  |  | |  |     | |                          | |                                
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****                  | |                 ******* ****     | |                          | |                                
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        | |                    |  |          ***                          ***                                
search RasMol script viewer Motif-ligand binding stats  nest ..                        ***                    |  |                                                                          
search RasMol script viewer Motif-ligand binding stats  niche ..                                               ****                                                                          

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  |               |    |          |  |  | |||||      |  |       | |      | **^*    | || |             |   || ||  ||  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |               |    |          |  |  | |||||      |  |       ^**      |  |      ^**^**             |   || ||  ||  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***               |    |          |  |  | |||||      ^***         |      |  |         | |             |   || ||  ||  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|     |               |    |          |  |  | |||||                   *******^  |         | |             |   || ||  ||  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|     |               ^*****          |  ^*****||||                          |  |         | |             ^***** ||  ||  |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|     |                               |  |  | |||||                          ^***         | |                 |  ||  ||  |   
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                               |  |  | |||||                                       | |                 |  ||  ||  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                      |  |  *****||                                       | |                 |  |*****  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                      ****  ******|                                       | |                 ************   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                               |  |                                       ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                               ****                                                                          

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  |               | ||||           | | |  ||  | |  | |  ||  |   | |      | **^*    | || |       |  |  |   || |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |               | ||||           | | |  ||  | |  | |  ||  |   ^**      |  |      ^**^**       |  |  |   || |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***               | ||||           | | |  ||  | |  | ^***|  |     |      |  |                   |  |  |   || |           
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|     |               | ||||           | | |  ||  | |  |     |  |     *******^  |                   |  |  |   || |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|     |               ^*****           | ^*****|  | |  |     |  |            |  |                   |  |  ^***** |           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|     |               | |||            | | |  ||  | |  |     |  |            ^***                   |  |      |  |           
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******               | |||            | | |  ||  | |  |     |  |                                   |  |      |  |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      | |||            | | *****  | |  |     |  |                                   |  |      |  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ****|            | | ******** ****     ****                                   |  |      ****           
search RasMol script viewer Motif-ligand binding stats  nest ..                        ***            ***     |  |                                                 |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                               ****                                                 ****                     

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|| |  |               |    |           | || ||||    |  | |  |       | |      | **^*|   | || |       |  |  |    |          | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| |  |               |    |           | || ||||    |  | |  |       ^**      |  || |   ^**^**       |  |  |    |          | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| ^***               |    |           | || ||||    |  | ^***         |      |  || |      | |       |  |  |    |          | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|| |  |               |    |           | || ||||    |  |              *******^  || |      | |       |  |  |    |          | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|| |  |               ^*****           | ^*****|    |  |                     |  || |      | |       |  |  ^*****          | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|| |  |                                | || ||||    |  |                     ^***| |      | |       |  |                  | |
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                                | || ||||    |  |                         | |      | |       |  |                  | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |  |                                | |*****|    |  |                         | |      | |       |  |                  | |
search RasMol script viewer Motif-ligand binding stats  betaturn .. | ****                                | |******    ****                         | |      | |       |  |                  | |
search RasMol script viewer Motif-ligand binding stats  nest .. ***                                   ***                                       | |      | |       |  |                  ***
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                 ***      | |       ****                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                          ***                                

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  |               | | ||          |  |  | ||| |  |  ||| || |    | |      | **^*    | || |             |   || |  ||       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |               | | ||          |  |  | ||| |  |  ||| || |    ^**      |  |      ^**^**             |   || |  ||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***               | | ||          |  |  | ||| |  |  |^***| |      |      |  |                         |   || |  ||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|     |               | | ||          |  |  | ||| |  |  | |  | |      *******^  |                         |   || |  ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|     |               ^*****          |  ^*****|| |  |  | |  | |             |  |                         ^***** |  ||       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|     |                 | |           |  |  |  || |  |  | |  | |             ^***                             |  |  ||       
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                 | |           |  |  |  || |  |  | |  | |                                              |  |  ||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        | |           |  |  ***** |  |  | |  | |                                              |  *****       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        | |           ****  ****  |  |  | |  | |                                              *******        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        | |                    |  |  |  | |  ***                                                             
search RasMol script viewer Motif-ligand binding stats  nest ..                        ***                    |  |  |  | |                                                                  
search RasMol script viewer Motif-ligand binding stats  niche ..                                               ****  ******                                                                  

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  |               |    |    | |      |    |     |  | |  |       | | |  | | **^*|   | || |             |   || | |  ||     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |               |    |    | |      |    |     |  | |  |       ^** |  | |  |  |   ^**^**             |   || | |  ||     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***               |    |    | |      |    |     |  | ^***         | |  | |  |  |                      |   || | |  ||     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|     |               |    |    | |      |    |     |  |              *******^  |  |                      |   || | |  ||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|     |               ^*****    | |      ^*****     |  |                |  | |  |  |                      ^***** | |  ||     
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|     |                         | |                 |  |                |  | ^***  |                          |  | |  ||     
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                         | |                 |  |                |  |    |  |                          |  | |  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                | |                 |  |                |  |    |  |                          |  | *****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                | |                 ****                |  |    ****                          **** ****      
search RasMol script viewer Motif-ligand binding stats  nest ..                                ***                                     |  |                                                 
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                        ****                                                 

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  |               | | ||             ||  ||     |  |||  |       | |  | | | **^*|   | || |       |  |  |   || ||  ||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |               | | ||             ||  ||     |  |||  |       ^**  | | |  |  |   ^**^**       |  |  |   || ||  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***               | | ||             ||  ||     |  ||^***         |  | | |  |  |                |  |  |   || ||  ||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|     |               | | ||             ||  ||     |  ||             *******^  |  |                |  |  |   || ||  ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|     |               ^*****             ^*****     |  ||                | | |  |  |                |  |  ^***** ||  ||      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|     |                 | |               |  ||     |  ||                | | ^***  |                |  |      |  ||  ||      
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                 | |               |  ||     |  ||                | |    |  |                |  |      |  ||  ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        | |               *****     *****                | |    |  |                |  |      |  |*****      
search RasMol script viewer Motif-ligand binding stats  asxturn ..                        | |               |  |      |  |                 ***    |  |                |  |      |  ||  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        | |               ****      ****                 | |    ****                |  |      ********       
search RasMol script viewer Motif-ligand binding stats  nest ..                        ***                                              | |                        |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                         ***                        ****                     

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| || ||               |    |            || || ||  |      |  || |    | |      | **^*|   | || |             | |  |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || ||               |    |            || || ||  |      |  || |    ^**      |  |  |   ^**^**             | |  |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |^***               |    |            || || ||  |      ^***| |      |      |  |  |                      | |  |             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| |  ||               |    |            || || ||  |          | |      *******^  |  |                      | |  |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |  ||               ^*****            |^*****|  |          | |             |  |  |                      ^*****             
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..| |  ||                                 |  ||  |  |          | |             ^***  |                      | |                
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                                 |  ||  |  |          | |                |  |                      | |                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |                                  *****  |  |          | |                |  |                      | |                
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****                                  ****   |  |          | |                ****                      | |                
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                               |  |          ***                                          | |                
search RasMol script viewer Motif-ligand binding stats  nest ..                                               |  |                                                       ***                
search RasMol script viewer Motif-ligand binding stats  niche ..                                               ****                                                                          

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| || ||               |    |            ||||| ||| | ||  ||| ||  |   | |      | **^*    | || |        | |  | |  |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || ||               |    |            ||||| ||| | ||  ||| ||  |   ^**      |  |      ^**^**        | |  | |  |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |^***               |    |            ||||| ||| | ||  |^***|  |     |      |  |         | |        | |  | |  |             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| |  ||               |    |            ||||| ||| | ||  | |  |  |     *******^  |         | |        | |  | |  |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |  ||               ^*****            |^*****|| | ||  | |  |  |            |  |         | |        | |  ^*****             
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..| |  ||                                 | ||| ||| | ||  | |  |  |            ^***         | |        | |  | |                
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                                 | ||| ||| | ||  | |  |  |                         | |        | |  | |                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****                                 | ||***** | ||  | |  |  |                         | |        | |  | |                
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****                                  ********  | ||  | |  |  |                         | |        | |  | |                
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                          |   |   | ||  | |  |  |                         ***        | |  | |                
search RasMol script viewer Motif-ligand binding stats  nest ..                                          |   |   ***|  | |  |  |                                    | |  ***                
search RasMol script viewer Motif-ligand binding stats  niche ..                                          |   |      ******  ****                                    ***                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                          *****                                                                              

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| || || |  || |       |    |            || || ||| |      |  ||  |   | |      | **^*    | || |           | ||   |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || || |  || |       |    |            || || ||| |      |  ||  |   ^**      |  |      ^**^**           | ||   |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |^*** |  || |       |    |            || || ||| |      ^***|  |     |      |  |                       | ||   |             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| |  || |  || |       |    |            || || ||| |          |  |     *******^  |                       | ||   |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |  || |  || |       ^*****            |^*****|| |          |  |            |  |                       | ^*****             
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..| |  || |  || |                         || || ||| |          |  |            ^***                       |  |                 
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..******* |  || |                         || || ||| |          |  |                                       |  |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |  |  || |                         ********* |          |  |                                       |  |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****  ****| |                         ********  |          |  |                                       ****                 
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                                |  |          |  |                                                            
search RasMol script viewer Motif-ligand binding stats  niche ..                                               ****          ****                                                            

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  |               | ||||             ||   |      |  ||  |       | |      | **^*    | || |             |    |       |  || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |               | ||||             ||   |      |  ||  |       ^**      |  |      ^**^**             |    |       |  || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***               | ||||             ||   |      |  |^***         |      |  |                         |    |       |  || 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|     |               | ||||             ||   |      |  |             *******^  |                         |    |       |  || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|     |               ^*****             ^*****      |  |                    |  |                         ^*****       |  || 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|     |                 ||||              |   |      |  |                    ^***                                      |  || 
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                 ||||              |   |      |  |                                                              |  || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        ||||              |   |      |  |                                                              ***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        ||||              |   |      |  |                                                              ****  
search RasMol script viewer Motif-ligand binding stats  nest ..                        ****              |   |      |  |                                                                    
search RasMol script viewer Motif-ligand binding stats  niche ..                                          |   |      ****                                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                          *****                                                                              

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| ||  |               |    |             || ||||         |  |       | |      | **^*|   | || |       |  |  |   || ||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ||  |               |    |             || ||||         |  |       ^**      |  |  |   ^**^**       |  |  |   || ||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |^***               |    |             || ||||         ^***         |      |  |  |                |  |  |   || ||          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| |   |               |    |             || ||||                      *******^  |  |                |  |  |   || ||          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |   |               ^*****             ^*****|                             |  |  |                |  |  ^***** ||          
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..| |   |                                   | ||||                             ^***  |                |  |      |  ||          
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                                   | ||||                                |  |                |  |      |  ||          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |                                       *****|                                |  |                |  |      *****          
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |                                       ******                                ****                |  |      ****           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***                                                                                                 |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                                    ****                     

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  ||              |    |            || || ||  | |   ||| |       | |      | **^*    | || |       |  |  | | || |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  ||              |    |            || || ||  | |   ||| |       ^**      |  |      ^**^**       |  |  | | || |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***|              |    |            || || ||  | |   |^***         |      |  |                   |  |  | | || |           
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  |  ||              |    |            || || ||  | |   | |           *******^  |                   |  |  | | || |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  ||              ^*****            |^*****|  | |   | |                  |  |                   |  |  ^***** |           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|  |  ||                                |  ||  |  | |   | |                  ^***                   |  |  | | |  |           
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******|                                |  ||  |  | |   | |                                         |  |  | | |  |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |   |                                *****  |  | |   | |                                         |  |  | | |  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |   |                                ********  | |   | |                                         |  |  | | ****           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |   |                                          | |   ***                                         |  |  | |                
search RasMol script viewer Motif-ligand binding stats  nest ..   |   |                                          ***                                               |  |  ***                
search RasMol script viewer Motif-ligand binding stats  niche ..   |   |                                                                                            ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****                                                                                                                     

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| || ||               |    |             ||| ||      |  ||| || |    | |      | **^*    | || |       |  |  | |  || || ||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || ||               |    |             ||| ||      |  ||| || |    ^**      |  |      ^**^**       |  |  | |  || || ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |^***               |    |             ||| ||      |  |^***| |      |      |  |                   |  |  | |  || || ||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| |  ||               |    |             ||| ||      |  | |  | |      *******^  |                   |  |  | |  || || ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |  ||               ^*****             ^*****      |  | |  | |             |  |                   |  |  ^*****| || ||      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..| |  ||                                   || ||      |  | |  | |             ^***                   |  |    |  || || ||      
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                                   || ||      |  | |  | |                                    |  |    |  || || ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| *****                                   *****      |  | |  | |                                    |  |    ***** *****      
search RasMol script viewer Motif-ligand binding stats  betaturn ..| ****                                    *****      |  | |  | |                                    |  |    ****  *****      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..| |                                                  |  ***  ***                                    |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..| |                                                  ****                                           ****                     
search RasMol script viewer Motif-ligand binding stats  stturn ..***                                                                                                                          

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  |               |    |         |  ||  | ||         |  |       | |  | | | **^*    | || |       |  |  | |  | || ||||  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |               |    |         |  ||  | ||         |  |       ^**  | | |  |      ^**^**       |  |  | |  | || ||||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***               |    |         |  ||  | ||         ^***         |  | | |  |                   |  |  | |  | || ||||  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  |  |               |    |         |  ||  | ||                      *******^  |                   |  |  | |  | || ||||  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  |               ^*****         |  |^*****|                         | | |  |                   |  |  ^***** || ||||  |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|  |  |                              |  |   |  |                         | | ^***                   |  |  | |    || ||||  |  
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                              |  |   |  |                         | |                        |  |  | |    || ||||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |                              |  |   |  |                         | |                        |  |  | |    ******|  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |                              |  |   |  |                         ***                        |  |  | |    || || |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****                              ****   ****                                                    |  |  | |    ***** ****  
search RasMol script viewer Motif-ligand binding stats  nest ..                                                                                                    |  |  ***                
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                                    ****                     

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  |               |    |   | |       |  | |||        |  |       | |      | **^*    | || ||            | |  |          | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |               |    |   | |       |  | |||        |  |       ^**      |  |      ^**^**|            | |  |          | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***               |    |   | |       |  | |||        ^***         |      |  |         |  |            | |  |          | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|     |               |    |   | |       |  | |||                     *******^  |         |  |            | |  |          | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|     |               ^*****   | |       ^*****||                            |  |         |  |            ^*****          | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|     |                        | |          |  ||                            ^***         |  |            | |             | |
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                        | |          |  ||                                         |  |            | |             | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                               | |          *****                                         |  |            | |             | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                               | |          ****                                          ****            | |             | |
search RasMol script viewer Motif-ligand binding stats  nest ..                               ***                                                                        ***             ***

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROFILIN IA
member of: CATH:search3.30.450.30GENE3D:searchG3DSA_3.30.450.30PANTHER:searchPTHR11604/searchPTHR11604_SF0PFAM:searchPF00235PRINTS:searchPROFILIN/searchPROFILINPLNTPROSITE PATTERNS:searchPS00414, SMART:searchSM00392SUPERFAMILY:searchSSF55770UniProt:searchP68696
sec str:  ....hhhhh..........eeeee.......eeee......hhhhhhhhhh..........eee..eeee.......eeeeee..eeeeeeee..eeeeeeee.......hhhhhhhhhhhhh....
sequence :  ..SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|||| ||               |    |             |    |          |  |       | |      | **^*|   | || |        | |  | |  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|||| ||               |    |             |    |          |  |       ^**      |  |  |   ^**^**        | |  | |  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|||^***               |    |             |    |          ^***         |      |  |  |                 | |  | |  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|||| ||               |    |             |    |                       *******^  |  |                 | |  | |  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|||| ||               ^*****             ^*****                              |  |  |                 | |  ^*****  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|||| ||                                                                      ^***  |                 | |  | |     |  |  ||   
search RasMol script viewer Motif-ligand binding stats  PROFILIN ..*******                                                                         |  |                 | |  | |     |  |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ||| |                                                                          |  |                 | |  | |     |  *****   
search RasMol script viewer Motif-ligand binding stats  betaturn .. |****                                                                          |  |                 | |  | |     *******    
search RasMol script viewer Motif-ligand binding stats  nest .. ***                                                                            |  |                 ***  ***                
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                ****                                         

   New search    2prf:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML