triangle PDBeMotif: 2pmw  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.
Classification hydrolase    | release date: Mon, Apr 23, 2007
Title the crystal structure of proprotein convertase subtilisin kexin type 9 (pcsk9)
Authors D.E.PIPER, N.P.C.WALKER, S.T.THIBAULT, W.G.ROMANOW
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GAMGQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRG
YLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Chain B sequence:
SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMAT
AVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHC
HQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTL
TGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
member of: GENE3D:searchG3DSA_3.30.70.80PANTHER:searchPTHR10795/searchPTHR10795_SF333PFAM:searchPF05922SUPERFAMILY:searchSSF52743/searchSSF54897UniProt:searchQ8NBP7
JMol viewer RasMol script viewer  SO4 302A  ..                             *  *                                             *             
JMol viewer RasMol script viewer  SO4 301A  ..                             |  |       *  **                                 |             
sec str:  ....eee...hhh.eeeeeeeeee....hhhhhhhhhhhhhhhhhhh....eeeeee.....eeeee.hhhhhhhhhh...eeeeeeeeeeee.
sequence :  ..TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
seq num:  ..61        71        81        91        101       111       121       131       141         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  | || |||  |     |  |  | ^**^**     || |||         |    |    | |   || ||  |||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  | || |||  |     |  |  ^***         || |||         |    |    | |   || ||  |||          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****  | || |||  |     |  |               || |||         ^*****    | |   || ||  |||          
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | || |||  |     |  |               || |||                   | |   || ||  |**          
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | *****|  |     |  |               |****|                   | |   ****|  |            
search RasMol script viewer Motif-ligand binding stats  nest ..      | ||  ||  |     |  |               |  ***                   | |    |  |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..      ***********     ****               |    |                   | |    *******            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                         ******                   | |                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                  ***                       

chain B : PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
member of: GENE3D:searchG3DSA_3.30.70.80/searchG3DSA_3.40.50.200PANTHER:searchPTHR10795/searchPTHR10795_SF333PFAM:searchPF00082PRINTS:searchSUBTILISINSUPERFAMILY:searchSSF52743UniProt:searchQ8NBP7
sec str:  ....hhhhhhh.............eeeeee.............eeeeeee.......hhhhhhhhhhhhhhhhhh.........eeeeee......eeehhhhhhhhhhhhhhhhhh....eeeee.eeee.hhhhhhhhhhhhhh..eeeee......hhh.ee.......eeeeee.......ee..ee........eeee...eeee.......eeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.ee...hhhhhhhhhh.....ee......... ......eeeeee..........eeee......eeeeeeee.....eeeeeeeee..eeeeeeee.......eeeeeeee....eeeeeee........eeee.....eeeeeeeee..........eeee....eeeeeeee...eeeeeeeeee.....eeeee.....eeeeeee......eeeeeee..eeeeee.... ....eeeeeeeeee..
sequence :  ..SIPWNLERITPPRYR..GGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEE..QASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPS... ..GWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDL..PNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSR... ..GAVTAVAICCRSRH
seq num:  ..153       163  ..176       186       196       206   ..219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439      ... ..452       462       472       482       492       502       512       522       532       542       552       562       ..585       595       605       615       625       635       645       655  ... ..670       680 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     ||  |     .. || ||    |   |  || |||||  | ||     ..  |  | |||  ||| |||| | |  || || |  | |||||   |                                       || |||       || | |  | | || ||   |  | |||   || |  | |  |            | ||  |     | |  |             |  ||  ||    |  | || ||| ||   ||  |          ..PS00001..              | |  |      |  |          | ||       |  |       |  |            | |^***               | |  |      |  |    ..      |  |        |  |                    |  |  ||                         ..PS00001..|    |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     ||  |     .. || ||    |   |  || |||||  | ||     ..  |  | |||  ||| ^**| | |  |^**^**  | |||||   |                                       || |||       || | |  | | || ||   |  | |||   || |  | |  |            | ||  |     | |  |             |  ||  ||    |  ^**| ||| ||   ||  |          ..PS00005..              | |  |      |  |          ^**|       |  |       |  |            | |                   | |  |      |  |    ..      |  |        |  |                    |  |  ||                         ..PS00005..|    |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ||  |     .. |^***    |   |  || |||||  ^***     ..  ^*** |||  ||| ^*** | |  |        | |||||   |                                       || |||       || | |  | | ^***|   |  | |||   || |  | |  |            | ||  |     | |  |             |  |^***|    |  ^*** ||| ||   ||  |          ..PS00006..              | |  |      |  |          | ||       |  |       |  |            | |                   | |  |      ^***    ..      |  |        |  |                    |  |  ||                         ..PS00006..|    |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     ||  |     .. |  |     |   |  || |||||  | |      ..     | |^*****| |||  ^*****        | |||^*****                                       || |||       || | |  | |  |  |   ^*****||   |^***** |  |            | ||  |     ^*****             |  ||   |    |  |  | ||| ||   ||  |          ..PS00008..              | |  |      |  |          | ||       |  |       |  |            | |                   | |  |              ..      |  |        |  |                    |  |  ||                         ..PS00008..^*****        
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..     ||  |     .. |  |     |   |  || |||||  | |      ..     | | |  | | |||  | |  |        | ||| |   |                                       || |||       || | |  | |  |  |      | |||   |  |    |  |            | ||  |       |                |  ||   |    |  |  | ||| ||   ||  |          ..PS00009..              | |  |      |  |          ^***       |  |       |  |            | |                   | |  |              ..      |  |        |  |                    |  |  ||                         ..PS00009..              
search RasMol script viewer Motif-ligand binding stats  betabulge ..     ||  |     .. |  |     |   |  || |||||  | |      ..     | | |  | | |||  | |  |        | ||| |   |                                       || |||       || | |  | |  |  |      | |||   |  |    |  |            | ||  |       |                |  ||   |    |  |  | ||| ||   ||  |          ..betabulge..              | |  |      |  |          | |        |  |       |  |            | |                   | |  |              ..      |  |        |  |                    |  |  **                         ..betabulge..              
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     ||  |     .. |  |     |   |  || |||||  | |      ..     | | |  | | |||  | |  |        ***** |   |                                       || |||       || | |  | |  |  |      *****   |  |    |  |            | ||  |       |                |  ||   |    |  |  | ||| ||   ||  |          ..betabulgeloop..              | |  |      |  |          | |        |  |       |  |            | |                   | |  |              ..      |  |        |  |                    |  |                             ..betabulgeloop..              
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ||  |     .. |  |     |   |  || ****|  | |      ..     | | |  | | |||  | ****        ****| |   |                                       |****|       || | |  | ****  |      ****|   ****    |  |            | |****       |                |  ||   |    |  |  | |****|   ||  |          ..betaturn..              | |  |      ****          | |        ****       ****            | |                   | |  |              ..      ****        |  |                    ****                             ..betaturn..              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     ||  |     .. |  |     |   |  ||  || |  | |      ..     | | |  | | |||  |               | | |   |                                       |  | |       || | |  | |  |  |        | |           |  |            | ||  |       |                |  ||   |    |  |  | | |  |   ||  |          ..gammaturn..              | |  |      |  |          | |                   |  |            ***                   | |  |              ..      |  |        |  |                    |  |                             ..gammaturn..              
search RasMol script viewer Motif-ligand binding stats  nest ..     ||  |     .. |  |     |   |  ||  |***  ***      ..     | | |  | | |||  |               *** |   |                                       |  ***       |*** |  | |  |  |        ***           |  |            | ||  |       |                |  ||   |    |  |  *** |  |   ||  |          ..nest..              | |  |      |  |          ***                   |  |                                  | |  |              ..      |  |        |  |                    |  |                             ..nest..              
search RasMol script viewer Motif-ligand binding stats  niche ..     |****     .. ****     |   ********     | |      ..     | | |  | ********                   |   |                                       |    |       |    **** *******                      ****            | |****       |                ****|   |    ****  *** ****   |****          ..niche..              ******      ****                                ****                                  ******              ..      ****        ****                    ****                             ..niche..              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..     |   |     ..          |                | |      ..     | | |  |   |                        |   |                                       ******       |                                                      | |           |                    |   |                     |   |          ..schellmannloop..                                                                                                                        ..                                                                           ..schellmannloop..              
search RasMol script viewer Motif-ligand binding stats  stmotif ..     |   |     ..          |                | |      ..     | | |  |   |                        |   |                                                    |                                                      | |           |                    *****                     |   |          ..stmotif..                                                                                                                        ..                                                                           ..stmotif..              
search RasMol script viewer Motif-ligand binding stats  ststaple ..     *****     ..          |                | |      ..     *****  *****                        *****                                                    |                                                      | |           |                                              *****          ..ststaple..                                                                                                                        ..                                                                           ..ststaple..              
search RasMol script viewer Motif-ligand binding stats  stturn ..               ..          |                ***      ..       |                                                                                          |                                                      ***           |                                                             ..stturn..                                                                                                                        ..                                                                           ..stturn..              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..               ..          *                         ..       *                                                                                          *                                                                    *                                                             ..REP00000..                                                                                                                        ..                                                                           ..REP00000..              

   New search    2pmw:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors