triangle PDBeMotif: 2peg  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification oxygen storage/transport    | release date: Tue, Apr 3, 2007
Title crystal structure of trematomus bernacchii hemoglobin in a partial hemichrome state
Authors A.MERLINO, A.VERGARA, L.MAZZARELLA, L.VITAGLIANO, M.FRANZESE
Method X-RAY DIFFRACTION (resolution: 1.48Å)
PDBe Citation   
Small molecules:    search ACE ACE binding statistics ACE   search HEM HEM binding statistics HEM
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPHIKAHGKKVMGGIALAVSKIDDLKTG
LMELSEQHAYKLRVDPANFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR
Chain B sequence:
VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAAHGIKVLHGLDRGVKNMDN
IAATYADLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HEMOGLOBIN SUBUNIT ALPHA
member of: CATH:search1.10.490.10GENE3D:searchG3DSA_1.10.490.10PANTHER:searchPTHR11442/searchPTHR11442_SF10PFAM:searchPF00042PRINTS:searchALPHAHAEM/searchPIHAEMPROSITE PROFILES:searchPS01033, SUPERFAMILY:searchSSF46458UniProt:searchP80043
JMol viewer RasMol script viewer  HEM 200A  ..                               *      *  ** *             *  **   *                *  **   * *   **  *                                  *     
JMol viewer RasMol script viewer  ACE 0A  ..*                              |      |  || |             |  ||   |                |  ||   | |   ||  |                                  |     
sec str:  ....hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..SLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPHIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPANFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ^**                              |  |   |  | | | |||    |  |   |    ||| ||               | || |                                  |   || |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***                               |  |   |  | | | |||    |  |   |    |^***|               | || |                                  |   || |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                   |  |   |  | | | |||    |  |   ^***** |  |               | || |                                  ^***** |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                                   |  |   |  | | | |||    ^***          |  |               | || |                                      |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..                                   |  |   |  | | | |||                  |  |               | |***                                      |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                   ****   |  | | ****|                  ****               | |                                         ****   
search RasMol script viewer Motif-ligand binding stats  nest ..                                          |  | | | |||                                     ***                                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                          **** | ****|                                                                                        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                               | *****                                                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                               ******                                                                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                 ***                                                                                          

chain B : HEMOGLOBIN SUBUNIT BETA
member of: CATH:search1.10.490.10GENE3D:searchG3DSA_1.10.490.10PANTHER:searchPTHR11442/searchPTHR11442_SF7PFAM:searchPF00042PRINTS:searchBETAHAEMPROSITE PROFILES:searchPS01033, SUPERFAMILY:searchSSF46458UniProt:searchP80044
JMol viewer RasMol script viewer  HEM 400B  ..                                     *  **  ..             *  **                       **   * *   **  *                                  *     
sec str:  .....hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSG..NAEAIIGNANVAAHGIKVLHGLDRGVKNMDNIAATYADLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH
seq num:  ..1         11        21        31        41  ..50        60        70        80        90        100       110       120       130       140    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**||   |  || ||     |   |     |  ^** |  ..||  |  |   |        |    |    |   |  |     ^**| || |                     |   |              | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***|   |  |^***     |   |     |  ||  |  ..||  |  |   |        |    |    |   ^***        | || |                     |   |              | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |   |   |  || |      |   |     |  ||  |  ..**  |  |   |        ^*****    |   |           | || |                     |   |              | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |   |   |  || |      |   |     |  ||  |  ..*****  *****                  |   |           | || |                     |   |              | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |   |   |  || |      |   |     |  ||  |  ..    |  |                      |   |           | |***                     |   |              | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |   |   |  || |      |   |     ********  ..    |  |                      |   |           | |                        |   |              | |  
search RasMol script viewer Motif-ligand binding stats  nest ..   |   |   |  || |      |   |               ..    |  |                      |   |           ***                        |   |              ***  
search RasMol script viewer Motif-ligand binding stats  niche ..   |   |   |  ****      |   |               ..    ****                      |   |                                      |   |                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..   *****   |   |        |   |               ..                              |   |                                      *****                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****        *****               ..                              *****                                                              

   New search    2peg:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors