triangle PDBeMotif: 2pc0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.23.16
Classification hydrolase    | release date: Thu, Mar 29, 2007
Title apo wild-type hiv protease in the open conformation
Authors C.D.STO, D.E.MCREE, H.HEASLET, J.H.ELDER, M.J.GIFFIN, R.ROSENFELD
Method X-RAY DIFFRACTION (resolution: 1.40Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search PGR PGR binding statistics PGR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEASE
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PFAM:searchPF00077PROSITE PATTERNS:searchPS00141, PROSITE PROFILES:searchPS50175, SUPERFAMILY:searchSSF50630UniProt:searchQ903N5
JMol viewer RasMol script viewer  PGR 907A  ..                                                              *        *                           
JMol viewer RasMol script viewer  MG 201A  ..                                                              |        |                           
sec str:  ...........eeeeee..eeeeeee.......ee........eeeeeee....eeeeeeeeeeeeee..eeeeeeeee......eehhhhhhhh......
sequence :  ..PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
seq num:  ..1001      1011      1021      1031      1041      1051      1061      1071      1081      1091     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**|  |   |  ||||| ||||             |    |            |  |        | |      |   | |||   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |  |   |  |^*** ^***             |    |            |  |        | |      |   | |||   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |   |  ||^*****|              ^*****            |  |        | |      |   | |^*****
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..              |  |   ***^********                                |  |        | |      |   | |||    
search RasMol script viewer Motif-ligand binding stats  asxturn ..              |  |      ***|                                     |  |        | |      |   | |||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****      || |                                     ****        | |      |   ****|    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        || |                                                 ***      |   | | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                        || |                                                          |   | ***    
search RasMol script viewer Motif-ligand binding stats  niche ..                        ****                                                          |   |        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        ||                                                            *****        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                        **                                                                         

   New search    2pc0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors