triangle PDBeMotif: 2p80  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   1.7.2.1
Classification oxidoreductase    | release date: Wed, Mar 21, 2007
Title solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis
Authors M.D.VLASIE, M.UBBINK
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search GD GD binding statistics GD   search CU CU binding statistics CU
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLEL
TLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLH
DGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLI
VHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVT
GEWNDDLMTSVLAPSGTIEGR
Chain D sequence:
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTP
HYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 348A  ..                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  GD 347A  ..                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  CU 346C  ..                                                                                                                                                                                                                                                                                                             *                                 
JMol viewer RasMol script viewer  CU 346A  ..                                                                                               *                                  *                                                                                                                                                                          |                                 
JMol viewer RasMol script viewer  CU 345A  ..                                                                                          *    |                                  |*        *    *                                                                                                                                                           |                                 
sec str:  ..hhhhhhhh.eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhhhhh.....eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee...............hhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  || ||         | |                              | |       ^***       |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ||| |||||       |  | |||  |   |  |               |         | |||  |  |         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  || ||         | |                              | |                  |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ^** |||||       |  | |||  |   |  |               |         | ^**  |  |         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***| ||         | |                              | |                  |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ||| |||||       |  | |||  |   |  |               |         | |||  ^***         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   || ||         | |                              | |                  |  |        |  |      ||  | ^*****|    |  |                   | ||| |||||^*****   |  ^***** |                     | |          |  ||| |||||       ^*****||  |   |  |               |         | |||  |            ^*****                ||  || | |          | |         ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  | | |                     | |          *****| |||||          | |||  |   |  |               |         | |||  |                                  |***** | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  | | |                     | |          |  | | |||||          | |||  |   |  |               |         | |||  |                                  *****  | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  *** |                     | |          |  | | |||||          | |||  |   |  |               |         | |||  |                                   |  |  | |          ***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****|         | |                              | |                  |  |        |  |      |****  **** |    ****                   ****| ******|       ****    | |                     | |          **** ******|          | |||  |   ****               |         ********                                   ****  | |                       
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |         | |                              ***                  |  |        |  |      ||  |     ***    |  |                     ***  |  ***               ***                     ***                   ***          ***||  |   |  |               |           ***  |                                         ***                       
search RasMol script viewer Motif-ligand binding stats  niche ..    ****         ***                                                   ****        ****      |****            ****                          |    |                                                             | |          ********   ****               |           | ****                                                                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                             |                                              ******                                                             | |                                        |           | |                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                             |                                                                                                                 ***                                        |           ***                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                             *                                                                                                                                                            *                                                                                    

chain B : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 347B  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  CU 346B  ..                                                                                                *                                  *                                                                                                                                                                                                            
JMol viewer RasMol script viewer  CU 345B  ..                                                                                           *    |                                  |*        *    *                                                                                                                                                                                             
JMol viewer RasMol script viewer  CU 346A  ..                                                                                           |    |                                  ||        |    |                                                                                                                                                           *                                 
sec str:  ...hhhhhhh..eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhhhhh.....eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee..............hhhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||||||         | |                              | |       ^***       |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  | |  || |       |  | ||| ||   |  |               |         | |||  |  |         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||||||         | |                              | |                  |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  ^**  || |       |  | ||| ||   |  |               |         | ^**  |  |         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***||||         | |                              | |                  |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  | |  || |       |  | ||| ||   |  |               |         | |||  ^***         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | ||||         | |                              | |                  |  |        |  |      ||  | ^*****| || |  |                   |  |      |^*****   |  ^***** |                     | |     |  | |  | |  || |       ^*****|| ||   |  |               |         | |||  |            ^*****                 |  || | |          ||| |       ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****|         | |                              | |                  |  |        |  |      ||  |  |  | | || |  |                   |  |      | |       |  |  | | |                     | |     |  | |  | |  || |          | ||| ||   |  |               |         | |||  |                                   ***** | |          ||| |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | || |         | |                              | |                  |  |        |  |      ||  |  |  | | || |  |                   |  |      | |       |  |  *** |                     | |     |  | |  | |  || |          | ||| ||   |  |               |         | |||  |                                   |  |  | |          *** |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   **** |         | |                              | |                  |  |        |  |      |****  **** | || ****                   ****      | |       ****    | |                     | |     **** **** ****| |          | |****|   ****               |         ********                                   ****  | |           |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |         | |                              ***                  |  |        |  |      ||  |     *** || |  |                             ***               ***                     ***                   ***          *** |  |   |  |               |           ***  |                                         ***           |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..     ****         ***                                                   ****        ****      |****     | **** ****                                                                                             | |              ****   ****               |             ****                                                       ****        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                              |         *****                                                                                                   | |                                        |                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              |                                                                                                                 ***                                        |                                                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                              *                                                                                                                                                            *                                                                                    

chain C : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 348C  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  GD 347C  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  CU 346C  ..                                                                                                *                                  *                                                                                                                                                                                                            
JMol viewer RasMol script viewer  CU 345C  ..                                                                                           *    |                                  |*        *    *                                                                                                                                                                                             
JMol viewer RasMol script viewer  CU 346B  ..                                                                                           |    |                                  ||        |    |                                                                                                                                                           *                                 
sec str:  ...hhhhhhh..eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhh........eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee...............hhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  || ||         | |                            | | |       ^***       |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  |||  || |       |  | |||  |   |  |               |         | |||  |  |         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  || ||         | |                            | | |                  |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  ^**  || |       |  | |||  |   |  |               |         | ^**  |  |         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***| ||         | |                            | | |                  |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  |||  || |       |  | |||  |   |  |               |         | |||  ^***         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    || ||         | |                            | | |                  |  |        |  |      ||  | ^*****|  | |  |                   |  |   || |^*****   |  ^***** |                     | |          |  |||  || |       ^*****||  |   |  |               |         | |||  |            ^*****                 |  || | |          | |         ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    || ||         | |                            | | |                  |  |        |  |      ||  |  |  | |  | |  |                   |  |   || |||       |  |    | |                     | |          *****|  || |          | |||  |   |  |               |         | |||  |                                   ***** | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..    || ||         | |                            *** |                  |  |        |  |      ||  |  |  | |  | |  |                   |  |   || |||       |  |    | |                     | |          |  | |  || |          | |||  |   |  |               |         | |||  |                                   |  |  | |          ***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|         | |                              | |                  |  |        |  |      |****  **** |  | ****                   ****   *****|       ****    | |                     | |          **** ****| |          | |||  |   ****               |         ****|  |                                   ****  | |                       
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |         | |                              ***                  |  |        |  |      ||  |     ***  | |  |                          |  ***               ***                     ***                   ***          ***||  |   |  |               |           ***  |                                         ***                       
search RasMol script viewer Motif-ligand binding stats  niche ..     ****         ***                                                   ****        ****      |****       **** ****                          |    |                                                             | |          ********   ****               |           | ****                                                                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                              |                                              ******                                                             | |                                        |           | |                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              |                                                                                                                 ***                                        |           ***                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                              *                                                                                                                                                            *                                                                                    

chain D : PSEUDOAZURIN
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PFAM:searchPF00127PRINTS:searchAMICYANIN/searchCOPPERBLUEPROSITE PATTERNS:searchPS00196, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02375UniProt:searchP04377
JMol viewer RasMol script viewer  CU 124D  ..                                       *                                     *  *                                          
sec str:  ...eeeeeeeeee..eeeeee..eeee....eeeeee.......ee...................eeee....eeeeee...hhhhh.eeeeee.....hhhhhhhh..hhhhhhhhhhhhhh..
sequence :  ..ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  | |         |  |     | |  |   ^**||||| |     |  |         |     |  || ||||            | ||^**     || |||   ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  | |         |  |     | |  |   ^***|||| |     |  |         |     |  || ||||            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          ^*****         |  |     | |  |    | ||||| |     |  |         |     |  || ||||            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  COPPER_BLUE ..          |  |           |  |     | |  |    | ||||| |     |  |         ******^********|            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |           |  |     | |  |    | ||||| |     |  |                  || ||||            | || |      |*****   |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****           ****     | |  |    ****|****     |  |                  *****||            ******      *****|   |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |     | |  |      | | | |     |  |                     |***              |  |           |   |  
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |     | |  |      *** | |     |  |                     ***               |  |           |   |  
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****     ******          ***     ****                                       ****           |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                    *****  

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 348A  ..                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  GD 347A  ..                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  CU 346C  ..                                                                                                                                                                                                                                                                                                             *                                 
JMol viewer RasMol script viewer  CU 346A  ..                                                                                               *                                  *                                                                                                                                                                          |                                 
JMol viewer RasMol script viewer  CU 345A  ..                                                                                          *    |                                  |*        *    *                                                                                                                                                           |                                 
sec str:  ..hhhhhhhh.eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhhhhh.....eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee...............hhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  || ||         | |                              | |       ^***       |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ||| |||||       |  | |||  |   |  |               |         | |||  |  |         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  || ||         | |                              | |                  |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ^** |||||       |  | |||  |   |  |               |         | ^**  |  |         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***| ||         | |                              | |                  |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ||| |||||       |  | |||  |   |  |               |         | |||  ^***         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   || ||         | |                              | |                  |  |        |  |      ||  | ^*****|    |  |                   | ||| |||||^*****   |  ^***** |                     | |          |  ||| |||||       ^*****||  |   |  |               |         | |||  |            ^*****                ||  || | |          | |         ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  | | |                     | |          *****| |||||          | |||  |   |  |               |         | |||  |                                  |***** | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  | | |                     | |          |  | | |||||          | |||  |   |  |               |         | |||  |                                  *****  | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  *** |                     | |          |  | | |||||          | |||  |   |  |               |         | |||  |                                   |  |  | |          ***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****|         | |                              | |                  |  |        |  |      |****  **** |    ****                   ****| ******|       ****    | |                     | |          **** ******|          | |||  |   ****               |         ********                                   ****  | |                       
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |         | |                              ***                  |  |        |  |      ||  |     ***    |  |                     ***  |  ***               ***                     ***                   ***          ***||  |   |  |               |           ***  |                                         ***                       
search RasMol script viewer Motif-ligand binding stats  niche ..    ****         ***                                                   ****        ****      |****            ****                          |    |                                                             | |          ********   ****               |           | ****                                                                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                             |                                              ******                                                             | |                                        |           | |                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                             |                                                                                                                 ***                                        |           ***                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                             *                                                                                                                                                            *                                                                                    

chain B : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 347B  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  CU 346B  ..                                                                                                *                                  *                                                                                                                                                                                                            
JMol viewer RasMol script viewer  CU 345B  ..                                                                                           *    |                                  |*        *    *                                                                                                                                                                                             
JMol viewer RasMol script viewer  CU 346A  ..                                                                                           |    |                                  ||        |    |                                                                                                                                                           *                                 
sec str:  ...hhhhhhh..eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhhhhh.....eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee..............hhhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||||||         | |                              | |       ^***       |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  | |  || |       |  | ||| ||   |  |               |         | |||  |  |         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||||||         | |                              | |                  |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  ^**  || |       |  | ||| ||   |  |               |         | ^**  |  |         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***||||         | |                              | |                  |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  | |  || |       |  | ||| ||   |  |               |         | |||  ^***         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | ||||         | |                              | |                  |  |        |  |      ||  | ^*****| || |  |                   |  |      |^*****   |  ^***** |                     | |     |  | |  | |  || |       ^*****|| ||   |  |               |         | |||  |            ^*****                 |  || | |          ||| |       ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****|         | |                              | |                  |  |        |  |      ||  |  |  | | || |  |                   |  |      | |       |  |  | | |                     | |     |  | |  | |  || |          | ||| ||   |  |               |         | |||  |                                   ***** | |          ||| |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | || |         | |                              | |                  |  |        |  |      ||  |  |  | | || |  |                   |  |      | |       |  |  *** |                     | |     |  | |  | |  || |          | ||| ||   |  |               |         | |||  |                                   |  |  | |          *** |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   **** |         | |                              | |                  |  |        |  |      |****  **** | || ****                   ****      | |       ****    | |                     | |     **** **** ****| |          | |****|   ****               |         ********                                   ****  | |           |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |         | |                              ***                  |  |        |  |      ||  |     *** || |  |                             ***               ***                     ***                   ***          *** |  |   |  |               |           ***  |                                         ***           |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..     ****         ***                                                   ****        ****      |****     | **** ****                                                                                             | |              ****   ****               |             ****                                                       ****        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                              |         *****                                                                                                   | |                                        |                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              |                                                                                                                 ***                                        |                                                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                              *                                                                                                                                                            *                                                                                    

chain C : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 348C  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  GD 347C  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  CU 346C  ..                                                                                                *                                  *                                                                                                                                                                                                            
JMol viewer RasMol script viewer  CU 345C  ..                                                                                           *    |                                  |*        *    *                                                                                                                                                                                             
JMol viewer RasMol script viewer  CU 346B  ..                                                                                           |    |                                  ||        |    |                                                                                                                                                           *                                 
sec str:  ...hhhhhhh..eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhh........eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee...............hhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  || ||         | |                            | | |       ^***       |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  |||  || |       |  | |||  |   |  |               |         | |||  |  |         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  || ||         | |                            | | |                  |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  ^**  || |       |  | |||  |   |  |               |         | ^**  |  |         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***| ||         | |                            | | |                  |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  |||  || |       |  | |||  |   |  |               |         | |||  ^***         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    || ||         | |                            | | |                  |  |        |  |      ||  | ^*****|  | |  |                   |  |   || |^*****   |  ^***** |                     | |          |  |||  || |       ^*****||  |   |  |               |         | |||  |            ^*****                 |  || | |          | |         ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    || ||         | |                            | | |                  |  |        |  |      ||  |  |  | |  | |  |                   |  |   || |||       |  |    | |                     | |          *****|  || |          | |||  |   |  |               |         | |||  |                                   ***** | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..    || ||         | |                            *** |                  |  |        |  |      ||  |  |  | |  | |  |                   |  |   || |||       |  |    | |                     | |          |  | |  || |          | |||  |   |  |               |         | |||  |                                   |  |  | |          ***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|         | |                              | |                  |  |        |  |      |****  **** |  | ****                   ****   *****|       ****    | |                     | |          **** ****| |          | |||  |   ****               |         ****|  |                                   ****  | |                       
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |         | |                              ***                  |  |        |  |      ||  |     ***  | |  |                          |  ***               ***                     ***                   ***          ***||  |   |  |               |           ***  |                                         ***                       
search RasMol script viewer Motif-ligand binding stats  niche ..     ****         ***                                                   ****        ****      |****       **** ****                          |    |                                                             | |          ********   ****               |           | ****                                                                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                              |                                              ******                                                             | |                                        |           | |                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              |                                                                                                                 ***                                        |           ***                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                              *                                                                                                                                                            *                                                                                    

chain D : PSEUDOAZURIN
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PFAM:searchPF00127PRINTS:searchAMICYANIN/searchCOPPERBLUEPROSITE PATTERNS:searchPS00196, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02375UniProt:searchP04377
JMol viewer RasMol script viewer  CU 124D  ..                                       *                                     *  *                                          
sec str:  ...eeeeeeeeee..eeeeee..eeee....eeeeee.......ee...................eeee....eeeeee...hhhhh.eeeeee.....hhhhhhhh..hhhhhhhhhhhhhh..
sequence :  ..ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  | |         |  |     | |  |   ^**||||| |     |  |         |     |  || ||||            | ||^**     || |||   ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  | |         |  |     | |  |   ^***|||| |     |  |         |     |  || ||||            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          ^*****         |  |     | |  |    | ||||| |     |  |         |     |  || ||||            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  COPPER_BLUE ..          |  |           |  |     | |  |    | ||||| |     |  |         ******^********|            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |           |  |     | |  |    | ||||| |     |  |                  || ||||            | || |      |*****   |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****           ****     | |  |    ****|****     |  |                  *****||            ******      *****|   |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |     | |  |      | | | |     |  |                     |***              |  |           |   |  
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |     | |  |      *** | |     |  |                     ***               |  |           |   |  
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****     ******          ***     ****                                       ****           |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                    *****  

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 348A  ..                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  GD 347A  ..                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  CU 346C  ..                                                                                                                                                                                                                                                                                                             *                                 
JMol viewer RasMol script viewer  CU 346A  ..                                                                                               *                                  *                                                                                                                                                                          |                                 
JMol viewer RasMol script viewer  CU 345A  ..                                                                                          *    |                                  |*        *    *                                                                                                                                                           |                                 
sec str:  ..hhhhhhhh.eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhhhhh.....eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee...............hhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  || ||         | |                              | |       ^***       |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ||| |||||       |  | |||  |   |  |               |         | |||  |  |         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  || ||         | |                              | |                  |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ^** |||||       |  | |||  |   |  |               |         | ^**  |  |         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***| ||         | |                              | |                  |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ||| |||||       |  | |||  |   |  |               |         | |||  ^***         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   || ||         | |                              | |                  |  |        |  |      ||  | ^*****|    |  |                   | ||| |||||^*****   |  ^***** |                     | |          |  ||| |||||       ^*****||  |   |  |               |         | |||  |            ^*****                ||  || | |          | |         ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  | | |                     | |          *****| |||||          | |||  |   |  |               |         | |||  |                                  |***** | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  | | |                     | |          |  | | |||||          | |||  |   |  |               |         | |||  |                                  *****  | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  *** |                     | |          |  | | |||||          | |||  |   |  |               |         | |||  |                                   |  |  | |          ***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****|         | |                              | |                  |  |        |  |      |****  **** |    ****                   ****| ******|       ****    | |                     | |          **** ******|          | |||  |   ****               |         ********                                   ****  | |                       
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |         | |                              ***                  |  |        |  |      ||  |     ***    |  |                     ***  |  ***               ***                     ***                   ***          ***||  |   |  |               |           ***  |                                         ***                       
search RasMol script viewer Motif-ligand binding stats  niche ..    ****         ***                                                   ****        ****      |****            ****                          |    |                                                             | |          ********   ****               |           | ****                                                                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                             |                                              ******                                                             | |                                        |           | |                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                             |                                                                                                                 ***                                        |           ***                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                             *                                                                                                                                                            *                                                                                    

chain B : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 347B  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  CU 346B  ..                                                                                                *                                  *                                                                                                                                                                                                            
JMol viewer RasMol script viewer  CU 345B  ..                                                                                           *    |                                  |*        *    *                                                                                                                                                                                             
JMol viewer RasMol script viewer  CU 346A  ..                                                                                           |    |                                  ||        |    |                                                                                                                                                           *                                 
sec str:  ...hhhhhhh..eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhhhhh.....eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee..............hhhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||||||         | |                              | |       ^***       |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  | |  || |       |  | ||| ||   |  |               |         | |||  |  |         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||||||         | |                              | |                  |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  ^**  || |       |  | ||| ||   |  |               |         | ^**  |  |         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***||||         | |                              | |                  |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  | |  || |       |  | ||| ||   |  |               |         | |||  ^***         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | ||||         | |                              | |                  |  |        |  |      ||  | ^*****| || |  |                   |  |      |^*****   |  ^***** |                     | |     |  | |  | |  || |       ^*****|| ||   |  |               |         | |||  |            ^*****                 |  || | |          ||| |       ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****|         | |                              | |                  |  |        |  |      ||  |  |  | | || |  |                   |  |      | |       |  |  | | |                     | |     |  | |  | |  || |          | ||| ||   |  |               |         | |||  |                                   ***** | |          ||| |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | || |         | |                              | |                  |  |        |  |      ||  |  |  | | || |  |                   |  |      | |       |  |  *** |                     | |     |  | |  | |  || |          | ||| ||   |  |               |         | |||  |                                   |  |  | |          *** |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   **** |         | |                              | |                  |  |        |  |      |****  **** | || ****                   ****      | |       ****    | |                     | |     **** **** ****| |          | |****|   ****               |         ********                                   ****  | |           |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |         | |                              ***                  |  |        |  |      ||  |     *** || |  |                             ***               ***                     ***                   ***          *** |  |   |  |               |           ***  |                                         ***           |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..     ****         ***                                                   ****        ****      |****     | **** ****                                                                                             | |              ****   ****               |             ****                                                       ****        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                              |         *****                                                                                                   | |                                        |                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              |                                                                                                                 ***                                        |                                                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                              *                                                                                                                                                            *                                                                                    

chain C : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 348C  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  GD 347C  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  CU 346C  ..                                                                                                *                                  *                                                                                                                                                                                                            
JMol viewer RasMol script viewer  CU 345C  ..                                                                                           *    |                                  |*        *    *                                                                                                                                                                                             
JMol viewer RasMol script viewer  CU 346B  ..                                                                                           |    |                                  ||        |    |                                                                                                                                                           *                                 
sec str:  ...hhhhhhh..eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhh........eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee...............hhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  || ||         | |                            | | |       ^***       |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  |||  || |       |  | |||  |   |  |               |         | |||  |  |         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  || ||         | |                            | | |                  |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  ^**  || |       |  | |||  |   |  |               |         | ^**  |  |         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***| ||         | |                            | | |                  |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  |||  || |       |  | |||  |   |  |               |         | |||  ^***         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    || ||         | |                            | | |                  |  |        |  |      ||  | ^*****|  | |  |                   |  |   || |^*****   |  ^***** |                     | |          |  |||  || |       ^*****||  |   |  |               |         | |||  |            ^*****                 |  || | |          | |         ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    || ||         | |                            | | |                  |  |        |  |      ||  |  |  | |  | |  |                   |  |   || |||       |  |    | |                     | |          *****|  || |          | |||  |   |  |               |         | |||  |                                   ***** | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..    || ||         | |                            *** |                  |  |        |  |      ||  |  |  | |  | |  |                   |  |   || |||       |  |    | |                     | |          |  | |  || |          | |||  |   |  |               |         | |||  |                                   |  |  | |          ***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|         | |                              | |                  |  |        |  |      |****  **** |  | ****                   ****   *****|       ****    | |                     | |          **** ****| |          | |||  |   ****               |         ****|  |                                   ****  | |                       
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |         | |                              ***                  |  |        |  |      ||  |     ***  | |  |                          |  ***               ***                     ***                   ***          ***||  |   |  |               |           ***  |                                         ***                       
search RasMol script viewer Motif-ligand binding stats  niche ..     ****         ***                                                   ****        ****      |****       **** ****                          |    |                                                             | |          ********   ****               |           | ****                                                                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                              |                                              ******                                                             | |                                        |           | |                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              |                                                                                                                 ***                                        |           ***                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                              *                                                                                                                                                            *                                                                                    

chain D : PSEUDOAZURIN
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PFAM:searchPF00127PRINTS:searchAMICYANIN/searchCOPPERBLUEPROSITE PATTERNS:searchPS00196, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02375UniProt:searchP04377
JMol viewer RasMol script viewer  CU 124D  ..                                       *                                     *  *                                          
sec str:  ...eeeeeeeeee..eeeeee..eeee....eeeeee.......ee...................eeee....eeeeee...hhhhh.eeeeee.....hhhhhhhh..hhhhhhhhhhhhhh..
sequence :  ..ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  | |         |  |     | |  |   ^**||||| |     |  |         |     |  || ||||            | ||^**     || |||   ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  | |         |  |     | |  |   ^***|||| |     |  |         |     |  || ||||            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          ^*****         |  |     | |  |    | ||||| |     |  |         |     |  || ||||            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  COPPER_BLUE ..          |  |           |  |     | |  |    | ||||| |     |  |         ******^********|            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |           |  |     | |  |    | ||||| |     |  |                  || ||||            | || |      |*****   |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****           ****     | |  |    ****|****     |  |                  *****||            ******      *****|   |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |     | |  |      | | | |     |  |                     |***              |  |           |   |  
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |     | |  |      *** | |     |  |                     ***               |  |           |   |  
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****     ******          ***     ****                                       ****           |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                    *****  

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 348A  ..                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  GD 347A  ..                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  CU 346C  ..                                                                                                                                                                                                                                                                                                             *                                 
JMol viewer RasMol script viewer  CU 346A  ..                                                                                               *                                  *                                                                                                                                                                          |                                 
JMol viewer RasMol script viewer  CU 345A  ..                                                                                          *    |                                  |*        *    *                                                                                                                                                           |                                 
sec str:  ..hhhhhhhh.eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhhhhh.....eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee...............hhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  || ||         | |                              | |       ^***       |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ||| |||||       |  | |||  |   |  |               |         | |||  |  |         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  || ||         | |                              | |                  |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ^** |||||       |  | |||  |   |  |               |         | ^**  |  |         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***| ||         | |                              | |                  |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ||| |||||       |  | |||  |   |  |               |         | |||  ^***         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   || ||         | |                              | |                  |  |        |  |      ||  | ^*****|    |  |                   | ||| |||||^*****   |  ^***** |                     | |          |  ||| |||||       ^*****||  |   |  |               |         | |||  |            ^*****                ||  || | |          | |         ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  | | |                     | |          *****| |||||          | |||  |   |  |               |         | |||  |                                  |***** | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  | | |                     | |          |  | | |||||          | |||  |   |  |               |         | |||  |                                  *****  | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  *** |                     | |          |  | | |||||          | |||  |   |  |               |         | |||  |                                   |  |  | |          ***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****|         | |                              | |                  |  |        |  |      |****  **** |    ****                   ****| ******|       ****    | |                     | |          **** ******|          | |||  |   ****               |         ********                                   ****  | |                       
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |         | |                              ***                  |  |        |  |      ||  |     ***    |  |                     ***  |  ***               ***                     ***                   ***          ***||  |   |  |               |           ***  |                                         ***                       
search RasMol script viewer Motif-ligand binding stats  niche ..    ****         ***                                                   ****        ****      |****            ****                          |    |                                                             | |          ********   ****               |           | ****                                                                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                             |                                              ******                                                             | |                                        |           | |                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                             |                                                                                                                 ***                                        |           ***                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                             *                                                                                                                                                            *                                                                                    

chain B : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 347B  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  CU 346B  ..                                                                                                *                                  *                                                                                                                                                                                                            
JMol viewer RasMol script viewer  CU 345B  ..                                                                                           *    |                                  |*        *    *                                                                                                                                                                                             
JMol viewer RasMol script viewer  CU 346A  ..                                                                                           |    |                                  ||        |    |                                                                                                                                                           *                                 
sec str:  ...hhhhhhh..eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhhhhh.....eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee..............hhhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||||||         | |                              | |       ^***       |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  | |  || |       |  | ||| ||   |  |               |         | |||  |  |         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||||||         | |                              | |                  |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  ^**  || |       |  | ||| ||   |  |               |         | ^**  |  |         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***||||         | |                              | |                  |  |        |  |      ||  | ||  ||| || |  |                   |  |      |||   |   |  |  | | |                     | |     |  | |  | |  || |       |  | ||| ||   |  |               |         | |||  ^***         |    |                 |  || | |          ||| |       |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | ||||         | |                              | |                  |  |        |  |      ||  | ^*****| || |  |                   |  |      |^*****   |  ^***** |                     | |     |  | |  | |  || |       ^*****|| ||   |  |               |         | |||  |            ^*****                 |  || | |          ||| |       ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****|         | |                              | |                  |  |        |  |      ||  |  |  | | || |  |                   |  |      | |       |  |  | | |                     | |     |  | |  | |  || |          | ||| ||   |  |               |         | |||  |                                   ***** | |          ||| |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | || |         | |                              | |                  |  |        |  |      ||  |  |  | | || |  |                   |  |      | |       |  |  *** |                     | |     |  | |  | |  || |          | ||| ||   |  |               |         | |||  |                                   |  |  | |          *** |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   **** |         | |                              | |                  |  |        |  |      |****  **** | || ****                   ****      | |       ****    | |                     | |     **** **** ****| |          | |****|   ****               |         ********                                   ****  | |           |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |         | |                              ***                  |  |        |  |      ||  |     *** || |  |                             ***               ***                     ***                   ***          *** |  |   |  |               |           ***  |                                         ***           |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..     ****         ***                                                   ****        ****      |****     | **** ****                                                                                             | |              ****   ****               |             ****                                                       ****        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                              |         *****                                                                                                   | |                                        |                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              |                                                                                                                 ***                                        |                                                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                              *                                                                                                                                                            *                                                                                    

chain C : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 348C  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  GD 347C  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  CU 346C  ..                                                                                                *                                  *                                                                                                                                                                                                            
JMol viewer RasMol script viewer  CU 345C  ..                                                                                           *    |                                  |*        *    *                                                                                                                                                                                             
JMol viewer RasMol script viewer  CU 346B  ..                                                                                           |    |                                  ||        |    |                                                                                                                                                           *                                 
sec str:  ...hhhhhhh..eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhh........eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee...............hhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  || ||         | |                            | | |       ^***       |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  |||  || |       |  | |||  |   |  |               |         | |||  |  |         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  || ||         | |                            | | |                  |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  ^**  || |       |  | |||  |   |  |               |         | ^**  |  |         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***| ||         | |                            | | |                  |  |        |  |      ||  | ||  |||  | |  |                   |  |   || |||   |   |  |    | |                     | |          |  |||  || |       |  | |||  |   |  |               |         | |||  ^***         |    |                 |  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    || ||         | |                            | | |                  |  |        |  |      ||  | ^*****|  | |  |                   |  |   || |^*****   |  ^***** |                     | |          |  |||  || |       ^*****||  |   |  |               |         | |||  |            ^*****                 |  || | |          | |         ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    || ||         | |                            | | |                  |  |        |  |      ||  |  |  | |  | |  |                   |  |   || |||       |  |    | |                     | |          *****|  || |          | |||  |   |  |               |         | |||  |                                   ***** | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..    || ||         | |                            *** |                  |  |        |  |      ||  |  |  | |  | |  |                   |  |   || |||       |  |    | |                     | |          |  | |  || |          | |||  |   |  |               |         | |||  |                                   |  |  | |          ***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|         | |                              | |                  |  |        |  |      |****  **** |  | ****                   ****   *****|       ****    | |                     | |          **** ****| |          | |||  |   ****               |         ****|  |                                   ****  | |                       
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |         | |                              ***                  |  |        |  |      ||  |     ***  | |  |                          |  ***               ***                     ***                   ***          ***||  |   |  |               |           ***  |                                         ***                       
search RasMol script viewer Motif-ligand binding stats  niche ..     ****         ***                                                   ****        ****      |****       **** ****                          |    |                                                             | |          ********   ****               |           | ****                                                                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                              |                                              ******                                                             | |                                        |           | |                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              |                                                                                                                 ***                                        |           ***                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                              *                                                                                                                                                            *                                                                                    

chain D : PSEUDOAZURIN
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PFAM:searchPF00127PRINTS:searchAMICYANIN/searchCOPPERBLUEPROSITE PATTERNS:searchPS00196, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02375UniProt:searchP04377
JMol viewer RasMol script viewer  CU 124D  ..                                       *                                     *  *                                          
sec str:  ...eeeeeeeeee..eeeeee..eeee....eeeeee.......ee...................eeee....eeeeee...hhhhh.eeeeee.....hhhhhhhh..hhhhhhhhhhhhhh..
sequence :  ..ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  | |         |  |     | |  |   ^**||||| |     |  |         |     |  || ||||            | ||^**     || |||   ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  | |         |  |     | |  |   ^***|||| |     |  |         |     |  || ||||            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          ^*****         |  |     | |  |    | ||||| |     |  |         |     |  || ||||            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  COPPER_BLUE ..          |  |           |  |     | |  |    | ||||| |     |  |         ******^********|            | || |      || |||   |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |           |  |     | |  |    | ||||| |     |  |                  || ||||            | || |      |*****   |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****           ****     | |  |    ****|****     |  |                  *****||            ******      *****|   |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |     | |  |      | | | |     |  |                     |***              |  |           |   |  
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |     | |  |      *** | |     |  |                     ***               |  |           |   |  
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****     ******          ***     ****                                       ****           |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                    *****  

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 348A  ..                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  GD 347A  ..                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  CU 346C  ..                                                                                                                                                                                                                                                                                                             *                                 
JMol viewer RasMol script viewer  CU 346A  ..                                                                                               *                                  *                                                                                                                                                                          |                                 
JMol viewer RasMol script viewer  CU 345A  ..                                                                                          *    |                                  |*        *    *                                                                                                                                                           |                                 
sec str:  ..hhhhhhhh.eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhhhhh.....eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee...............hhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  || ||         | |                              | |       ^***       |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ||| |||||       |  | |||  |   |  |               |         | |||  |  |         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  || ||         | |                              | |                  |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ^** |||||       |  | |||  |   |  |               |         | ^**  |  |         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***| ||         | |                              | |                  |  |        |  |      ||  | ||  |||    |  |                   | ||| |||||||   |   |  |  | | |                     | |          |  ||| |||||       |  | |||  |   |  |               |         | |||  ^***         |    |                ||  || | |          | |         |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   || ||         | |                              | |                  |  |        |  |      ||  | ^*****|    |  |                   | ||| |||||^*****   |  ^***** |                     | |          |  ||| |||||       ^*****||  |   |  |               |         | |||  |            ^*****                ||  || | |          | |         ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  | | |                     | |          *****| |||||          | |||  |   |  |               |         | |||  |                                  |***** | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  | | |                     | |          |  | | |||||          | |||  |   |  |               |         | |||  |                                  *****  | |          | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..   || ||         | |                              | |                  |  |        |  |      ||  |  |  | |    |  |                   | ||| |||||||       |  |  *** |                     | |          |  | | |||||          | |||  |   |  |               |         | |||  |                                   |  |  | |          ***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****|         | |                              | |                  |  |        |  |      |****  **** |    ****                   ****| ******|       ****    | |                     | |          **** ******|          | |||  |   ****               |         ********                                   ****  | |                       
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |         | |                              ***                  |  |        |  |      ||  |     ***    |  |                     ***  |  ***               ***                     ***                   ***          ***||  |   |  |               |           ***  |                                         ***                       
search RasMol script viewer Motif-ligand binding stats  niche ..    ****         ***                                                   ****        ****      |****            ****                          |    |                                                             | |          ********   ****               |           | ****                                                                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                             |                                              ******                                                             | |                                        |           | |                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                             |                                                                                                                 ***                                        |           ***                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                             *                                                                                                                                                            *                                                                                    

chain B : COPPER-CONTAINING NITRITE REDUCTASE
member of: CATH:search2.60.40.420GENE3D:searchG3DSA_2.60.40.420PANTHER:searchPTHR11709/searchPTHR11709_SF57PFAM:searchPF00394/searchPF07732PRINTS:searchCUNO2RDTASEPROSITE PROFILES:searchPS51318, SUPERFAMILY:searchSSF49503TIGRFAMS:searchTIGR02376UniProt:searchP38501
JMol viewer RasMol script viewer  GD 347B  ..                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  CU 346B  ..                                                                                                *                                  *                                                                                                                                                                                                            
JMol viewer RasMol script viewer  CU 345B  ..                                                                                           *    |                                  |*        *    *                                                                                                                                                                                             
JMol viewer RasMol script viewer  CU 346A  ..                                                                                           |    |                                  ||        |    |                                                                                                                                                           *                                 
sec str:  ...hhhhhhh..eee.....................eeeeeeeeeeeeee......eeeeeee........eeee...eeeeeeee..........ee.....hhhhhhhh.....eeeeeeee....eee.ee.....hhhhhhhh.....eeee....ee.....ee...eeeeeeeeee..............hhhhhhhhhhhhhhh....eeee.......hhhhheeee...eeeeeeee.............eeeee.........eeee........eeeeeeee....eeeeee..hhhhhhh...eeeeeee.......eeeeeeee.
sequence :  ..ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334   
search RasMol script viewer Motif-ligand binding stats