triangle PDBeMotif: 2p2b  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   6.2.1.1
Classification ligase    | release date: Wed, Mar 7, 2007
Title acetyl-coa synthetase, v386a mutation
Authors A.M.GULICK, A.S.REGER
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search PRX PRX binding statistics PRX   search COA COA binding statistics COA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSAGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACETYL-COENZYME A SYNTHETASE
member of: CATH:search3.30.300.30GENE3D:searchG3DSA_2.30.38.10/searchG3DSA_3.30.300.30/searchG3DSA_3.40.50.980HAMAP:searchMF_01123PANTHER:searchPTHR24095/searchPTHR24095_SF116PFAM:searchPF00501/searchPF13193PROSITE PATTERNS:searchPS00455, SUPERFAMILY:searchSSF56801TIGRFAMS:searchTIGR02188UniProt:searchQ8ZKF6
JMol viewer RasMol script viewer  PRX 999A  ..                                                                                                                                                                                                                                                                                                                 **                                                                          ****                     ******                                                                                   *           *  *          *                                                                                                ..PRX ..               
JMol viewer RasMol script viewer  COA 990A  ..                                                                                                                                                              ***                         *  * *                                                                                                                 ||                     ***                       **  *                      ||||                     ||||||                                                                                   |           |  |       * *|                                                         *    *                                 ..COA ..               
sec str:  .......hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeee......eeee....eehhhhhhh..hhhhhh..eeeeee......eeeeehhhhhhhhhhhhhhhhhhh.....eeeee...hhhhhhhhhhhhhhh.eeee.....hhhhhhhhhhhhh..eeeee.eeee..eeeehhhhhhhhhhh.......eeeee.............eeehhhhhhhh........ee...eeeeeee.......eeeeeehhhhhhhhhhhhhhhh......eeee.....hhhhhhh.hhhhhhhh.eeeee.........hhhhhhhhhhh..eeeehhhhhhhhhhhhhhhh.........eeeee....hhhhhhhhhhhh......eeee..hhhhh..........................eeee..........eeeeeee.........ee..hhhhhhhhhhh.....eeeeeeeee.....eeeeee...eeee..eeeehhhhhhhhhh...eeeeeeeeeee...eeeeeeeeee......hhhhhhhhhhhhhhhhhhhhh..eeee............hhhhhhhhhhh.... .....hhhhhhhhhhhh
sequence :  ..HKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDLIEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSAGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGD... ..ADPGVVEKLLEEKQA
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615     ... ..633       643  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |       |  |             |  |        |  |          ^***|  ^***| | ||               |  |      | | ||| | | |||         | ||||||  |                  || |||   | |  ||   |      ||||   |  || |  |          |  | ^***||       | ||              |  || |      |  | |||      | | ||    |    ||  || |  | ||  |   | || ||           | |||       |  | | |        | |            || || | ||||||||||   |  |  |   |       | | |       || |        |  |  |  |    | ||   | | |||   |    |      | ||   |  |  |  || ||||| |  | |  | | ||||  | |     ^***|          |  |  |||    |    |           |  |                   |  |            | |||          | |..PS00001.. |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..**       |  |             |  |        |  |            | |  | ^** | ||               |  |      | | ||| | ^**||         | ||||||  |                  || |||   | |  ||   |      |^**   |  || |  |          |  | ||| ||       | ||              |  || |      |  | |||      ^** ||    |    ||  |^**  | ||  |   | || ||           | |||       |  | | |        | |            || || | |||^**|^**   |  |  |   |       | | |       || |        |  |  |  |    | ||   | | |||   |    |      | ||   |  |  |  || ||^** |  | |  | | ||||  ^**      |  |          |  |  |||    |    |           |  |                   |  |            | ^**          | |..PS00005.. |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |             ^***        |  |            | |  |     | ||               |  |      | | ||| | ^***|         ^***||||  |                  || |||   | |  ||   |      | |    ^***| |  |          |  | ||^***       ^***              |  || |      |  | |||          ||    |    ||  ||    | ||  |   | || ||           | |||       |  | | |        | |            || || | |||||||||    ^***  |   |       | | |       || |        |  |  |  |    | ||   | | |||   |    |      | ||   |  |  |  || || |  |  | |  | | ||||           |  |          |  |  |||    |    |           |  |                   |  |            | |||          | |..PS00006..**             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         |  |                         |  |            | |  |     | ||               |  |      | | ||| | |  ||           | ||||  |                  || |||   | |  ||   |      | |        | |  |          |  | ||| |        | |               |  || |      |  | |||          ||    |    ||  ||    | ||  |   | || ||           | |||       |  | | |        | |            || || | |||||||||          |   |       | | |       || |        |  |  |  |    | ||   | | |||   |    |      | ||   |  |  |  || || |  |  | |  *******^           |  |          |  |  |||    |    |           |  |                   |  |            | |||          | |..PS00007..               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |                         |  |            | |  |     | ||               |  |      | | ||| | |  ||           | |^*****                  || |^***** |  ||   |      | |        ^*****          |  | ||| |        | |               |  || |      |  | |||          |^*****    ||  ||    | ||  |   | || ||           | |||       |  | | |        | |            || || | ||^*****|          |   |       | | |       || |        |  |  |  |    | ^***** | |||   ^*****      | ^*****  |  |  || || |  |  | |    | |||            |  |          |  |  |||    ^*****           |  |                   |  |            | |||          | |..PS00008..               
search RasMol script viewer Motif-ligand binding stats  EF_HAND_1 ..         |  |                         |  |            | |  |     | ||               |  |      | ^*^*^*^*^**^*           | ||||  |                  || |||     |  ||   |      | |          |  |          |  | ||| |        | |               |  || |      |  | |||          |          ||  ||    | ||  |   | || ||           | |||       |  | | |        | |            || || | || ||||||          |   |       | | |       || |        |  |  |  |    |  |     | |||               |  |   |  |  |  || || |  |  | |    | |||            |  |          |  |  |||                     |  |                   |  |            | |||          | |..PS00018..               
search RasMol script viewer Motif-ligand binding stats  AMP_BINDING ..         |  |                         |  |            | |  |     | ||               |  |      | |  |    |   |           | ||||  |                  || |||     |  ||   |      | |          |  |          |  | ||| |        | |               |  || |      |  | ||************          ||  ||    | ||  |   | || ||           | |||       |  | | |        | |            || || | || ||||||          |   |       | | |       || |        |  |  |  |    |  |     | |||               |  |   |  |  |  || || |  |  | |    | |||            |  |          |  |  |||                     |  |                   |  |            | |||          | |..PS00455..               
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  |                         |  |            | |  |     | ||               |  |      | |  |    |   |           | ||||  |                  || |||     |  ||   |      | |          |  |          |  | ||| |        | |               |  || |      |  | ||                      ||  ||    | ||  |   | || ||           | |||       |  | | |        | |            || || | || ||||||          *****       | | |       || |        |  |  |  |    |  |     | |||               |  |   |  |  |  || || |  |  | |    | |||            |  |          |  |  |||                     |  |                   |  |            | |||          | |..asxmotif..               
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |                         |  |            | |  |     | ||               |  |      | |  |    |   |           | ||||  |                  || |||     |  ||   |      | |          |  |          |  ***|| |        | |               |  || |      |  | ||                      ||  ||    | ||  |   | |***|           | |||       |  | | |        | |            || || | || |***||                      | | |       || |        |  |  |  |    |  |     | |||               |  |   |  |  |  || || |  |  | |    | |||            |  |          |  |  |||                     |  |                   |  |            | |||          | |..asxturn..               
search RasMol script viewer Motif-ligand binding stats  betabulge ..         |  |                         |  |            | |  |     | ||               |  |      | |  |    |   |           | ||||  |                  || |||     |  ||   |      | |          |  |          |  |  || |        | |               |  || |      |  | **                      ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | || ||||||                      | | |       || |        |  |  |  |    |  |     | |||               |  |   |  |  |  || || |  |  | |    | |||            |  |          |  |  |**                     |  |                   |  |            | |||          | |..betabulge..               
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  |                         |  |            | |  |     | ||               |  |      | |  |    |   |           | ||||  |                  || |||     |  ||   |      | |          |  |          |  |  || |        | |               |  || |      |  |                         ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | || ||||||                      | | |       || |        |  |  |  |    |  |     *****               |  |   |  |  |  || || |  |  | |    *****            |  |          |  |  |                       |  |                   |  |            *****          | |..betabulgeloop..               
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |                         |  |            | ****     | ||               |  |      | |  |    |   |           ****|****                  |****|     |  ||   |      | |          ****          |  |  || |        | |               |  || |      |  |                         ||  ||    | |****   | ||  |           ****|       |  | | |        | |            ******* ****|||||                      | | |       ****        |  |  ****    ****     ****|               |  |   ****  |  || || ****  | |    ****|            ****          |  ****                       ****                   |  |            ****|          | |..betaturn..               
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                         |  |            | |        ***|               |  |      | |  |    |   |             ***|  |                  |  ***     |  ||   |      ***                        |  |  || |        ***               |  || |      |  |                         ||  ||    ***|  |   | ||  |             ***       |  | | |        ***                  | || |****|                      *****        |          |  |  |  |    |  |       ***               |  |         |  || || |  |  ***      ***                          |  |  |                       |  |                   |  |              ***          ***..nest..               
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                         ****            ***        ****               ****      ******    |   |                ****                  |    |     ****|   |                                 **********        | |               *******      ****                         ||  ||       ****   *******                       **** | |                             ****** ****                                   |          ****  ****    ****                         ****         |  || *******  | |                                   *******                       ****                   ****                              ..niche..               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      | |                                               |   |                                      ******         |   |                                                   | |                   | |                                   ||  ||                                                 | |                                                                           |                                                                  |  ||  |       | |                                                                                                                          ..schellmannloop..               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                      | |                                               *****                                                     *****                                                   | |                   | |                                   ||  ||                                                 | |                                                                           |                                                                  |  ||  |       | |                                                                                                                          ..stmotif..               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                      | |                                                                                                                                                                 | |                   | |                                   ******                                                 | |                                                                           |                                                                  ********       | |                                                                                                                          ..ststaple..               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                      ***                                                                                                                                                                 ***                   ***                                                                                          ***                                                                           |                                                                                 ***                                                                                                                          ..stturn..               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                                                                                                                                                                           *                                                                                                                                                                                                              ..REP00000..               

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ACETYL-COENZYME A SYNTHETASE
member of: CATH:search3.30.300.30GENE3D:searchG3DSA_2.30.38.10/searchG3DSA_3.30.300.30/searchG3DSA_3.40.50.980HAMAP:searchMF_01123PANTHER:searchPTHR24095/searchPTHR24095_SF116PFAM:searchPF00501/searchPF13193PROSITE PATTERNS:searchPS00455, SUPERFAMILY:searchSSF56801TIGRFAMS:searchTIGR02188UniProt:searchQ8ZKF6
JMol viewer RasMol script viewer  PRX 998B  ..                                                                                                                                                                                                                                                                                                                 **                                                                           ***                     ******                                                                                   *           *  *          *                                                                                                ..PRX ..                     
JMol viewer RasMol script viewer  COA 991B  ..                                                                                                                                                              ***                         ** * *                                                                                                                 ||                     ****                          *                       |||                     ||||||                                                                                   |           |  |       *  |                                                         *    *                                 ..COA ..                     
sec str:  .......hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeee......eeee....eehhhhhhh..hhhhhh..eeeeee......eeeeehhhhhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhhhhhh.eeee.....hhhhhhhhhhhhh..eeeee.eeee..eeeehhhhhhhhh.........eeeee.............eeehhhhhh..........ee...eeeeeee.......eeeeeehhhhhhhhhhhhhhhh......eeee.....hhhhhhh.hhhhhhh..eeeee.........hhhhhhhhhhh..eeeehhhhhhhhhhhhhhhh.........eeeee....hhhhhhhhhhhh......eeee..hhhhh..........................eeee..........eeeeeee.........ee..hhhhhhhhhhh.....eeeeeeeee.....eeeeee...eeee..eeeehhhhhhhhhhh..eeeeeeeeeee...eeeeeeeeee......hhhhhhhhhhhhhhhhhhhhh..eeee............hhhhhhhhhhh.... ...hhhhh...hhhhhhhhhhhh
sequence :  ..HKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDLIEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSAGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGD... ..GDTSTLADPGVVEKLLEEKQA
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615     ... ..627       637        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |       |  |  | |        |  |        |  |          ^***|  ^***| | ||               |  | ||   | | ||| | | |||     |   ||||||||  |                     |||   | |  ||   |      ||||   |  ||    |          |  | ^***||       | ||              |  || |      |  |   |      | | ||    |    ||  || |  | ||  |   | ||  |           | |||       |  | | |        | |            || || | ||||||||||   |  |  | |         | | |       || |   ||   |  |  |  |    | ||   | | |||   |    |      | ||   |  |  |  ||  |||| |  | |  | | ||||  | |     ^***|          |  |  |||    |    |           |  |                   |  |      | |   | |||          | |..PS00001..  | || |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..**       |  |  | |        |  |        |  |            | |  | ^** | ||               |  | ||   | | ||| | ^**||     |   ||||||||  |                     |||   | |  ||   |      |^**   |  ||    |          |  | ||| ||       | ||              |  || |      |  |   |      ^** ||    |    ||  |^**  | ||  |   | ||  |           | |||       |  | | |        | |            || || | |||^**|^**   |  |  | |         | | |       || |   ||   |  |  |  |    | ||   | | |||   |    |      | ||   |  |  |  ||  |^** |  | |  | | ||||  ^**      |  |          |  |  |||    |    |           |  |                   |  |      | |   | ^**          | |..PS00005..  | || |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |  | |        ^***        |  |            | |  |     | ||               |  | ||   | | ||| | ^***|     |   ^***||||  |                     |||   | |  ||   |      | |    ^***|    |          |  | ||^***       ^***              |  || |      |  |   |          ||    |    ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | |||||||||    ^***  | |         | | |       || |   ||   |  |  |  |    | ||   | | |||   |    |      | ||   |  |  |  ||  | |  |  | |  | | ||||           |  |          |  |  |||    |    |           |  |                   |  |      | |   | |||          | |..PS00006..  | ^***             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         |  |  | |                    |  |            | |  |     | ||               |  | ||   | | ||| | |  ||     |   ||| ||||  |                     |||   | |  ||   |      | |        |    |          |  | ||| |        | |               |  || |      |  |   |          ||    |    ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | |||||||||          | |         | | |       || |   ||   |  |  |  |    | ||   | | |||   |    |      | ||   |  |  |  ||  | |  |  | |  *******^           |  |          |  |  |||    |    |           |  |                   |  |      | |   | |||          | |..PS00007..  |  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |  | |                    |  |            | |  |     | ||               |  | ||   | | ||| | |  ||     |   ||| |^*****                     |^***** |  ||   |      | |        ^*****          |  | ||| |        | |               |  || |      |  |   |          |^*****    ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | ||^*****|          | |         | | |       || |   ||   |  |  |  |    | ^***** | |||   ^*****      | ^*****  |  |  ||  | |  |  | |    | |||            |  |          |  |  |||    ^*****           |  |                   |  |      | |   | |||          | |..PS00008..  |  |               
search RasMol script viewer Motif-ligand binding stats  EF_HAND_1 ..         |  |  | |                    |  |            | |  |     | ||               |  | ||   | ^*^*^*^*^**^*     |   ||| ||||  |                     | |     |  ||   |      | |                        |  | ||| |        | |               |  || |      |  |   |          |          ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | || ||||||          | |         | | |       || |   ||   |  |  |  |    |  |     | |||               |  |   |  |  |  ||  | |  |  | |    | |||            |  |          |  |  |||                     |  |                   |  |      | |   | |||          | |..PS00018..  |  |               
search RasMol script viewer Motif-ligand binding stats  AMP_BINDING ..         |  |  | |                    |  |            | |  |     | ||               |  | ||   | | ||    |   |     |   ||| ||||  |                     | |     |  ||   |      | |                        |  | ||| |        | |               |  || |      |  |   ************          ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | || ||||||          | |         | | |       || |   ||   |  |  |  |    |  |     | |||               |  |   |  |  |  ||  | |  |  | |    | |||            |  |          |  |  |||                     |  |                   |  |      | |   | |||          | |..PS00455..  |  |               
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  |  | |                    |  |            | |  |     | ||               |  | ||   | | ||    |   |     |   ||| ||||  |                     | |     |  ||   |      | |                        |  ***** |        | |               |  || |      |  |                         ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | || ||||||          | |         | | |       || |   ||   |  |  |  |    |  |     | |||               |  |   |  |  |  ||  | |  |  | |    | |||            |  |          |  |  |||                     |  |                   |  |      | |   | |||          | |..asxmotif..  |  |               
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |  ***                    |  |            | |  |     | ||               |  | ||   | ***|    |   |     |   ||| ||||  |                     | |     |  ||   |      | |                        |  ***|| |        | |               |  || |      |  |                         ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | || |***||          ***         | | |       || |   ||   |  |  |  |    |  |     | |||               |  |   |  |  |  ||  | |  |  | |    | |||            |  |          |  |  |||                     |  |                   |  |      | |   | |||          | |..asxturn..  |  |               
search RasMol script viewer Motif-ligand binding stats  betabulge ..         |  |                         |  |            | |  |     | ||               |  | **   | |  |    |   |     |   ||| ||||  |                     | |     |  ||   |      | |                        |  |  || |        | |               |  || |      |  |                         ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | || ||||||                      | | |       || |   **   |  |  |  |    |  |     | |||               |  |   |  |  |  ||  | |  |  | |    | |||            |  |          |  |  |**                     |  |                   |  |      | |   | |||          | |..betabulge..  |  |               
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  |                         |  |            | |  |     | ||               |  |      | |  |    |   |     |   ||| ||||  |                     | |     |  ||   |      | |                        |  |  || |        | |               |  || |      |  |                         ||  ||    | ||  |   | ||  |           | |||       |  | | |        | |            || || | || ||||||                      | | |       || |        |  |  |  |    |  |     *****               |  |   |  |  |  ||  | |  |  | |    *****            |  |          |  |  |                       |  |                   |  |      | |   *****          | |..betabulgeloop..  |  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |                         |  |            | ****     ****               |  |      | |  |    |   |     |   ||****|****                     | |     |  ||   |      | |                        |  ****| |        | |               |  || |      ****                         ||  ||    | |****   | ||  |           ****|       |  | | |        | |            ***** | ****|||||                      | | |       ****        |  |  |  |    ****     ****|               |  |   ****  |  ||  | ****  | |    ****|            ****          |  |  |                       |  |                   |  |      | |   ****|          | |..betaturn..  |  |               
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                         |  |            | |        ***|               |  |      | |  |    |   |     |   ||  ***|  |                     ***     |  ||   |      ***                        |  |  || |        ***               |  || |      |  |                         ||  ||    ***|  |   | ||  |             ***       |  | | |        ***                  | || |****|                      *****        |          |  |  |  |    |  |       ***               |  |         |  ||  | |  |  ***      ***                          |  |  |                       |  |                   |  |      | |     ***          ***..nest..  |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                         ****            ***        ****               ****      ******    |   |     |   ||    |****                             ****|   |                                 **********        | |               *******      ****                         ||  ||       ****   *******                       **** | |                             ****** ****                        ***        |          ****  ****    ****                         ****         |  ||  | ****  | |                                   *******                       ****                   ****      | |                     ..niche..  ****               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      | |                                               |   |     |   |******                                     |   |                                                   | |                   | |                                   ||  ||                                                 | |                                                                           |                                                                  |  ||  |       | |                                                                                                  | |                     ..schellmannloop..                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                      | |                                               *****     |   |                                           *****                                                   | |                   | |                                   ||  ||                                                 | |                                                                           |                                                                  |  ||  |       | |                                                                                                  | |                     ..stmotif..                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                      | |                                                         *****                                                                                                   | |                   | |                                   ******                                                 | |                                                                           |                                                                  ********       | |                                                                                                  | |                     ..ststaple..                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                      ***                                                                                                                                                                 ***                   ***                                                                                          ***                                                                           |                                                                                 ***                                                                                                  ***                     ..stturn..                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                                                                                                                                                                           *                                                                                                                                                                                                              ..REP00000..                     

   New search    2p2b:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors