triangle PDBeMotif: 2ooq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.3.48
Classification hydrolase    | release date: Fri, Jan 26, 2007
Title crystal structure of the human receptor phosphatase ptprt
Authors A.BARR, A.EDWARDS, C.H.ARROWSMITH, DELFT, E.SALAH, E.UGOCHUKWU, F, G.BUNKOCZI, I.ALFANO, J.ESWARAN, J.WEIGELT, M.SUNDSTROM, P.SAV, S.KNAPP, STRUCTURAL GENOMICS CONSORTIUM (SGC), T.KEATES
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search NA NA binding statistics NA   search B3P B3P binding statistics B3P   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SMAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINA
NYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYV
IRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAE
NEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLCGNTAI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE T
member of: CATH:search3.90.190.10GENE3D:searchG3DSA_3.90.190.10PANTHER:searchPTHR19134/searchPTHR19134_SF208PFAM:searchPF00102PRINTS:searchPRTYPHPHTASEPROSITE PATTERNS:searchPS00383, PROSITE PROFILES:searchPS50055/searchPS50056, SMART:searchSM00194SUPERFAMILY:searchSSF52799UniProt:searchO14522
JMol viewer RasMol script viewer  B3P 301A  ..                                                                    ..                                                                                * *        *              *                            *                                                                          
sec str:  ....ee..hhhhhhhhhhh....hhhhhhhhh............hhhhhhhh.......hhhhh........hhhhhh..eeee........eeee......hhhhhhhhhhhhh..eeee....ee..ee.........eeee..eeeeeeeeee...eeeeeeeeee......eeeeeeee...........hhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhhhhhhhhhheehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh
sequence :  ..MAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVL..DPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLC
seq num:  ..889       899       909       919       929       939       949     ..959       969       979       989       999       1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   || ||     |  ||    |  || ||  |    | ^**|  || ||  |    ||  |      ..| || |       |  | | |      |  ^**|       | |                           || |  | ||               |  | |        | |||| |               |  ||  |    | | ||||  |      |  |  ||| |  ||      |  |  |  |   |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   || ||     |  ||    |  || ||  |    | ^***  || ||  |    ||  |      ..| || |       |  | | |      |  ^***       | |                           || |  ^***               |  | |        | ^*** |               |  ||  |    | | ||||  |      ^***  ||| |  ||      |  |  |  |   |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   || ||     |  |^*****  || ||  ^***** |  |  || ||  ^*****|  |      ..| || |       |  | | |      |  |          | |                           || |    ||               |  | |        |  ||  |               |  ||  |    | | |^*****            ||| |  ||      |  |  |  |   |             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHATASE_1 ..   || ||     |  |        || ||         |  |  || ||        |  |      ..| || |       |  | | |      |  |          | |                           || |    ||               |  | |        |  ||  |               |  ||  |    **^********            ||| |  ||      |  |  |  |   |             
search RasMol script viewer Motif-ligand binding stats  betabulge ..   || ||     |  |        || ||         |  |  || ||        |  |      ..| || |       |  | | |      |  |          | |                           || |    **               |  | |        |  ||  |               |  ||  |        ||||               ||| |  ||      |  |  |  |   |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..   *****     |  |        ****|         **********|        |  |      ..**** |       |  | | |      ****          | |                           ****                     **** |        |  |****               |  ||  |        ||||               ||| |  ||      |  |  |  |   |             
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |         |  |         |  |   |  |        |  |      ..  |  |       |  | ***                    ***                            | |                     |  | |        |  |                   |  ||  |        ****               ||***  ||      |  |  |  |   |             
search RasMol script viewer Motif-ligand binding stats  niche ..             ****         ****         ****   ****        ****      ..  ****       ****                                                       ***                     ******        ****                   ********                           ||     ||      *******  |   |             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                    ..                                                                                                                                         |                              ||     ||               *****             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                    ..                                                                                                                                         *                              **     **                                 

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE T
member of: CATH:search3.90.190.10GENE3D:searchG3DSA_3.90.190.10PANTHER:searchPTHR19134/searchPTHR19134_SF208PFAM:searchPF00102PRINTS:searchPRTYPHPHTASEPROSITE PATTERNS:searchPS00383, PROSITE PROFILES:searchPS50055/searchPS50056, SMART:searchSM00194SUPERFAMILY:searchSSF52799UniProt:searchO14522
JMol viewer RasMol script viewer  EDO 502B  ..                                                                                                                                                                                        *   *                                   *                                         *              
JMol viewer RasMol script viewer  B3P 301B  ..                                                                                                                                                       * *        *              *      |   |                                   |                                         |              
JMol viewer RasMol script viewer  NA 501B  ..                                                                                                                                                       | |        |              |      |   |                                   |                                         |              
sec str:  .....ee..hhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhh.......hhhhh................eeee........eeee...hhhhhhhhhhhhhhhh..eeee....ee..ee.........eeee..eeeeeeeeee...eeeeeeeeee.....eeeeeeeee...........hhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhhhhhhhhhheehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh
sequence :  ..SMAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLC
seq num:  ..888       898       908       918       928       938       948       958       968       978       988       998       1008      1018      1028      1038      1048      1058      1068      1078      1088      1098      1108      1118      1128      1138      1148      1158       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  ||     |  || | ||   |  |  |    | ^**|  || ||  |    ||  |     |  | |  || |    |  | | |      |  ^**|       | |                           || |  | ||               |  | |        | || |                 |  ||  |    | | ||||  |  |   |  |  ||| |  ||      |  |  || |   |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |  ||     |  || | ||   |  |  |    | ^***  || ||  |    ||  |     |  | |  || |    |  | | |      |  ^***       | |                           || |  ^***               |  | |        | ^***                 |  ||  |    | | ||||  |  |   ^***  ||| |  ||      |  |  || |   |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |  ||     |  |^*****   |  |  ^***** |  |  || ||  ^*****|  |     |  | |  || |    |  | | |      |  |          | |                           || |    ||               |  | |        |  |                   |  ||  |    | | |^*****  |   |     ||| |  ||      |  |  || |   |             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHATASE_1 ..    |  ||     |  |  | |    |  |         |  |  || ||        |  |     |  | |  || |    |  | | |      |  |          | |                           || |    ||               |  | |        |  |                   |  ||  |    **^********  |   |     ||| |  ||      |  |  || |   |             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    *****     |  |  | |    |  |         |  |  || ||        |  |     |  | |  || |    |  | | |      |  |          | |                           || |    ||               |  | |        |  |                   |  ||  |        ||||     |   |     ||| |  ||      |  |  || |   |             
search RasMol script viewer Motif-ligand binding stats  betabulge ..    |  |      |  |  | |    |  |         |  |  || ||        |  |     |  | |  || |    |  | | |      |  |          | |                           || |    **               |  | |        |  |                   |  ||  |        ||||     |   |     ||| |  ||      |  |  || |   |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****      |  |  | |    |  |         **********|        |  |     **** |  || |    |  | | |      ****          | |                           ****                     **** |        |  |                   |  ||  |        ||||     |   |     ||| |  ||      |  |  || |   |             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              |  |  | |    |  |         |  |   |  |        |  |     |  | |  |***    |  | | |                    | |                            | |                     |  | |        |  |                   |  ||  |        ||||     |   |     ||| |  ||      |  |  || |   |             
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |  ***    |  |         |  |   |  |        |  |     |  | |  |       |  | ***                    ***                            | |                     |  | |        |  |                   |  ||  |        ****     |   |     ||***  ||      |  |  |***   |             
search RasMol script viewer Motif-ligand binding stats  niche ..              ****         ****         ****   ****        ****     **** ****       ****                                                       ***                     ******        ****                   ********                 |   |     ||     ||      *******  |   |             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                                                                                                |                    |   |     ||     ||               *****             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                |                    *****     ||     ||                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                *                              **     **                                 

   New search    2ooq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors