triangle PDBeMotif: 2o94  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Wed, Dec 13, 2006
Title the 97h/f mutant structure of a glutamine-rich domain from histone deacetylase 4
Authors A.HAN, D.L.BATES, L.CHEN, L.GUO
Method X-RAY DIFFRACTION (resolution: 3.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
GSSHHHHHHSSGLVPRGSHMAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQLSRQHEAQLHEHIKQQQEMLAM
KHQQELLEHQRKLERHRQEQELEKQHREQKLQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HISTONE DEACETYLASE 4
member of: PFAM:searchPF12203PIRSF:searchPIRSF037911UniProt:searchP56524
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..AEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLE
seq num:  ..62        72        82        92        102       112       122     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..**  ||  |  ||  ||  |  || |||                    |  ||     |  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****  *********  *********                    *****     *****     
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****   ********   ********                     ****      ****      

chain B : HISTONE DEACETYLASE 4
member of: PFAM:searchPF12203PIRSF:searchPIRSF037911UniProt:searchP56524
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..AEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLE
seq num:  ..62        72        82        92        102       112       122     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..**  ||       |  || |  || |||    |  ||                               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****       ***** *********    *****                               
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****        ****  ********     ****                                

chain C : HISTONE DEACETYLASE 4
member of: PFAM:searchPF12203PIRSF:searchPIRSF037911UniProt:searchP56524
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..AEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLE
seq num:  ..62        72        82        92        102       112       122     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..**|  ||  |  || ||  |  ||  ||                     |  ||    |  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****  ********  *********                     *****    *****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****   ********  ********                      ****     ****      

chain D : HISTONE DEACETYLASE 4
member of: PFAM:searchPF12203PIRSF:searchPIRSF037911UniProt:searchP56524
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..AEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLE
seq num:  ..62        72        82        92        102       112       122     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..**           |  || |  || |||    |  ||          |  ||      |  |||  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             ***** *********    *****          *****      *****|  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****  ********     ****           ****       **** **** 

   New search    2o94:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors