triangle PDBeMotif: 2o93  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription/dna    | release date: Wed, Dec 13, 2006
Title crystal structure of nfat bound to the hiv-1 ltr tandem kappab enhancer element
Authors D.L.BATES, L.CHEN
Method X-RAY DIFFRACTION (resolution: 3.05Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains L,M,O sequence:
MRGSHHHHHHTAPHASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQ
IFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGR
KNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTD
GQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain L : ACTOR OF ACTIVATED T-CELLS, CYTOPLASMIC 2
member of: CATH:search2.60.40.10/search2.60.40.340GENE3D:searchG3DSA_2.60.40.10/searchG3DSA_2.60.40.340PANTHER:searchPTHR12533/searchPTHR12533_SF4PFAM:searchPF00554/searchPF01833PRINTS:searchNUCFACTORATCPROSITE PROFILES:searchPS50254, SMART:searchSM00429SUPERFAMILY:searchSSF49417/searchSSF81296UniProt:searchQ13469
sec str:  ...................eeeeee...........................eeeee.......eeeeeeeee...........eeeee..........eeeee..eeeeeeeehhhhh.eee...eeeee.hhhhhhhh...........eeeeeeeeeee.....eeee......ee..........eeeee...eee.....eeeeeee.....eeeeeeee.....eeeeeeeee........eeeee............eeeeeeeee........eeeeee..
sequence :  ..ASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
seq num:  ..392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | |  |             ||         |  ||    | | |||     |  | |           |  |     |  |     | | |  |  |   | |        | |||            |  ||  |  | || |||||            | |             | ||  |    ||      |  |       | ^*** |    | || |||         | | ||  |            | |         |  | ||          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| | |  |             ||         |  ||    | | |||     |  | |           |  |     |  |     | | |  |  |   | |        | |||            |  ||  |  | || **^*|            | |             | ||  |    ||      |  |       |  ||| |    | || |||         | | ||  |            | |         |  **^*          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| | |  |             ||         |  ||    | | |||     |  | |           |  |     |  |     ^** |  |  |   | |        | |||            |  ||  |  | ||  ||||            ^**             ^**|  |    ||      |  |       |  ||| |    ^**| |||         | | ||  |            | |         |  |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| | |  |             ||         |  ||    | | |||     |  | |           ^***     |  |       | |  ^***   | |        | |||            |  ||  |  | ||  ||||            | |                ^***    ||      |  |       |  ||| |       | |||         | | ||  |            | |         |  |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| | |  |             ||         |  |^***** | |||     |  | |                    |  |       | |         | |        | |||            |  ||  |  | ||  ||||            | |                        ||      |  |       ^***** |       | |||         | | ||  |            | |         |  |             
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..| | |  |             ||         |  |       | |||     |  | |                    |  |       | |         | |        | |||            |  ||  |  | |^***|||            | |                        ||      |  |       |  ||  |       | |||         | | ||  |            | |         ^***             
search RasMol script viewer Motif-ligand binding stats  asxturn ..| | |  |             ||         |  |       | |||     |  | |                    |  |       | |         | |        | |||            |  ||  |  | |   ||||            | |                        ||      |  |       |  ||  |       | |||         *** ||  |            | |                          
search RasMol script viewer Motif-ligand binding stats  betabulge ..| | |  |             **         |  |       | |||     |  | |                    |  |       | |         | |        | |||            |  ||  |  | |   ||||            | |                        **      |  |       |  ||  |       | |||           | ||  |            | |                          
search RasMol script viewer Motif-ligand binding stats  betaturn ..| | |  |                        |  |       ****|     |  | |                    |  |       | |         | |        ****|            ********  | |   ||||            | |                                ****       |  ||  |       ****|           | ||  |            | |                          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..*** |  |                        |  |         | |     |  | |                    |  |       | |         | |          | |                |  |  | |   ***|            | |                                           |  ||  |       | | |           | ||  |            | |                          
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |                        |  |         ***     |  | |                    |  |       | |         | |          ***                |  |  | |    | |            ***                                           |  ||  |       | ***           | ||  |            | |                          
search RasMol script viewer Motif-ligand binding stats  niche ..    ****                        ****                 ******                    ****       ***         ***                             ****  ***    ***                                                          ********       | | |           *******            ***                          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                                                                                                               *****                                                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                               ***                                                             

chain M : ACTOR OF ACTIVATED T-CELLS, CYTOPLASMIC 2
member of: CATH:search2.60.40.10/search2.60.40.340GENE3D:searchG3DSA_2.60.40.10/searchG3DSA_2.60.40.340PANTHER:searchPTHR12533/searchPTHR12533_SF4PFAM:searchPF00554/searchPF01833PRINTS:searchNUCFACTORATCPROSITE PROFILES:searchPS50254, SMART:searchSM00429SUPERFAMILY:searchSSF49417/searchSSF81296UniProt:searchQ13469
sec str:  ...........ee..eeeeeee........ee.................eeeee.......eeeeeeee............eeeee..........eeeee..eeeeeeeehhhhh.ee....eeeee.hhhhhhh............eeeeeeeeeee.....eeee......ee..........eeeee...eee.....eeeeeee......eeeeeee.....eeeeeeeee........eeeee............eeeeeeee.........eeeeee..
sequence :  ..VPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
seq num:  ..395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635       645       655       665       675 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                             |  ||    |   | |     |  | | |         | ||     |  |     ||||| ||  |   | |          | ||   | |     || ||| |  | |||||||           | |||             | ||  |    ||                 | ^***|||   | || ||| ||        | ||  |                        |  | ||          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                             |  ||    |   | |     |  | | |         | ||     |  |     ||||| ||  |   | |          | ||   | |     || ||| |  | |||**^*           | |||             | ||  |    ||                 |  ||||||   | || ||| ||        | ||  |                        |  **^*          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                             |  ||    |   | |     |  | | |         | ||     |  |     ^**|| ||  |   | |          | ||   | |     || ||| |  | ||||||            | ^**             ^**|  |    ||                 |  ||||||   ^**| ||| ||        | ||  |                        |  | |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                             |  ||    |   | |     |  | | |         ^***     |  |      | || |^***   | |          | ||   | |     || ||| |  | ||||||            | |||                ^***    ||                 |  ||||||      | ||| ||        | ||  |                        |  | |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                             |  |^*****   | |     |  | | |         | |      |  |      | || |       | |          | ||   | |     || ||| |  | ||||||            | |||                        ||                 ^*****|||      | ||| ||        | ||  |                        |  | |           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                             |  |         | |     |  | | |         | |      |  |      | || |       | |          | ||   | |     || ||| |  | |^***|            | |||                        ||                 |  || |||      | ||| ||        | ||  |                        ^*** |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                             |  |         | |     |  | | |         | |      |  |      | || |       | |          | ||   | |     ****** |  | |||| |            | |||                        ||                 |  || |||      | ||| ||        | ||  |                           | |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..                             |  |         | |     |  | | |         | |      |  |      | || |       | |          | ||   | |     || ||  |  | |||| |            | |||                        **                 |  || |||      | ||| **        | ||  |                           | |           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                             |  |         | |     |  | | |         | |      |  |      | || |       | |          | ||   | |     || ||  |  | |||| |            | |||                                           |  || |||      *****           | ||  |                           | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                             ****         | |     |  | | |         | |      |  |      | || |       | |          ****   | |     ********  | ||****            ****|                                           |  |****|      ****|           | ||  |                           | |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             |  |         | |     |  | | |         | |      |  |      ***| |       | |          | |    | |         |  |  | || |                | |                                           |  || |||        | |           | ||  |                           ***           
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  |         ***     |  | | |         | |      |  |         | |       | |          ***    | |         |  |  | || |                ***                                           |  || |||        ***           | ||  |                                         
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****         | |     ********         ***      ****         ***       ***                 ***         ****  ******                                                              ********|                      *******                                         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                          | |                                                                                                                                                                    *****                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                          ***                                                                                                                                                                    ***                                                                        

chain O : ACTOR OF ACTIVATED T-CELLS, CYTOPLASMIC 2
member of: CATH:search2.60.40.10/search2.60.40.340GENE3D:searchG3DSA_2.60.40.10/searchG3DSA_2.60.40.340PANTHER:searchPTHR12533/searchPTHR12533_SF4PFAM:searchPF00554/searchPF01833PRINTS:searchNUCFACTORATCPROSITE PROFILES:searchPS50254, SMART:searchSM00429SUPERFAMILY:searchSSF49417/searchSSF81296UniProt:searchQ13469
sec str:  ...................eeeeee...........................eeeee.......eeeeeeeee...........eeeee..........eeeee..eeeeeeeehhhhh.......eeeee.hhhhhh.............eeeeeeeeeee.....eeee......ee.hhhhhhh..eeeee...eee.....eeeeeee.......eeeeee.....eeeeeeeeeeeeeee..eeeee............eeeeeee..........eeeeee..
sequence :  ..ASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
seq num:  ..392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    |  |      | |               |  ||| | | | |||     |  |             | |||    |  |     | | | ||  |              | |||   |  |         |  |     ||||||             | |             | ||  |      | |      | |     | ^***|||   | || ||| ||      | | ||  |       | |  |           || ||||          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |  |      | |               |  ||| | | | |||     |  |             | |||    |  |     | | | ||  |              | |||   |  |         |  |     ||**^*             | |             | ||  |      | |      | |     |   |||||   | || ||| ||      | | ||  |       | |  |           || **^*          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  |      | |               |  ||| | | | |||     |  |             | |||    |  |     ^** | ||  |              | |||   |  |         |  |     ||||||             ^**             ^**|  |      | |      | |     |   |||||   ^**| ||| ||      | | ||  |       | |  |           || ||            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |  |      | |               |  ||| | | | |||     |  |             ^***|    |  |       | | |^***              | |||   |  |         |  |     ||||||             | |                ^***      | |      | |     |   |||||      | ||| ||      | | ||  |       | |  |           || ||            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |  |      | |               |  |^***** | |||     |  |               | |    |  |       | | |                  | |||   |  |         |  |     ||||||             | |                          | |      | |     ^*****|||      | ||| ||      | | ||  |       | |  |           || ||            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    |  |      | |               |  | | |   | |||     |  |               | |    |  |       | | |                  | |||   |  |         |  |     ^***||             | |                          | |      | |         | |||      | ||| ||      | | ||  |       | |  |           ^***|            
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |  |      | |               |  | | |   | |||     |  |               | |    |  |       | | |                  | |||   |  |         |  |      |||||             | |                          | |      | |         | |||      | ||| ||      *** ||  |       | |  |            |  |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..    |  |      | |               |  | | |   | |||     |  |               | |    |  |       | | |                  | |||   |  |         |  |      |||||             | |                          | |      | |         | |||      | ||| **      |   ||  |       | |  |            |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  |      | |               |  | | |   ****|     |  |               | |    |  |       | | |                  ****|   |  |         |  |      ****|             | |                          | |      | |         ****|      ****|         |   ||  |       | |  |            |  |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    |  |      | |               |  | | |     | |     |  |               | |    |  |       | | |                    | |   |  |         |  |       ****             | |                          | |      ***         | |||        | |         |   ||  |       | |  |            |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |      | |               |  | | |     ***     |  |               | |    |  |       | | |                    ***   |  |         |  |                        ***                          | |                  | |||        ***         |   ||  |       | |  |            |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..    ****      ***               **** | |     | |     ****               ***    ****       *****                          ****         ****                                                     ***                  ****|                    |   |****       ******            ****            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                     | |     | |                                                                                                                                                                    *****                    |   |                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                     | |     | |                                                                                                                                                                    | |                      *****                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                     ***     ***                                                                                                                                                                    ***                                                                        

chain A : KAPPAB ENHANCER ELEMENT, DNA 25-MER
sec str:  ...........................
sequence :  ..AGGGACTTTCCGCTGGGGACTTTCC
seq num:  ..1         11        21   

chain B : KAPPAB ENHANCER ELEMENT, DNA 25-MER
sec str:  ...........................
sequence :  ..TGGAAAGTCCCCAGCGGAAAGTCCC
seq num:  ..1         11        21   

   New search    2o93:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors