triangle PDBeMotif: 2nz2  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   6.3.4.5
Classification ligase    | release date: Wed, Nov 22, 2006
Title crystal structure of human argininosuccinate synthase in com aspartate and citrulline
Authors A.EDWARDS, A.FLORES, A.G.THORSELL, A.MAGNUSDOTT, B.M.HAL, C.ARROWSMITH, C.PERSSON, D.OGG, H.BERGLUND, I.JOHANSSON, J.SA, J.UPPENBERG, J.WEIGELT, K.WALLDE, L.HOLMBERG-SCHIAVONE, M.E.NILSSON, M.HAMMARSTROM, M.HOGBOM, M.MOCHE, M.SUNDSTROM, P.NORDLUND, P.STENMARK, R.C, R.D.BUSAM, S.FLODIN, S.GRASLUND, S.VAN DEN BERG, STRUCTURAL GENOMICS CONSORTI, T.KARLBERG, T.KOTENYOVA, T.NYMAN, U.B.ERICSSON
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Small molecules:    search ASP ASP binding statistics ASP   search NA NA binding statistics NA   search CIR CIR binding statistics CIR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SMSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS
SALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRND
LMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVK
DGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAE
LVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRL
KEYHRLQSKVTAK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARGININOSUCCINATE SYNTHASE
member of: CATH:search1.20.5.470/search3.40.50.620/search3.90.1260.10GENE3D:searchG3DSA_1.20.5.470/searchG3DSA_3.40.50.620/searchG3DSA_3.90.1260.10HAMAP:searchMF_00005PANTHER:searchPTHR11587/searchPTHR11587_SF1PFAM:searchPF00764PROSITE PATTERNS:searchPS00564/searchPS00565, SUPERFAMILY:searchSSF52402/searchSSF69864TIGRFAMS:searchTIGR00032UniProt:searchP00966
JMol viewer RasMol script viewer  CIR 502A  ..                                                                                   *   *                               **  *                            ..CIR ..                        **      * *                                                                              *           *                                                                                              ..CIR ..                              
JMol viewer RasMol script viewer  ASP 501A  ..                                                                                   |   |                          **  ***  |                            ..ASP ..                        ||      | *                                                                              |           |                                                                                              ..ASP ..                              
JMol viewer RasMol script viewer  NA 503A  ..                                                                                   |   |                          ||  |||  |                            ..NA ..                        ||      | |                                                                              |           |                                                                                              ..NA ..                              
sec str:  ...eeeeee...hhhhhhhhhhhhhh.eeeeeeeee.....hhhhhhhhhhhhh..eeeeeehhhhhhhhhhhhhhhh..hhhhh......hhhhhhhhhhhhhhhhhh..eee.......hhhhhhhhhhhhhh...eeehhhhhhhhhh...... ..hhhhhhhhhhh.............eee....eee.hhhhhh.....hhhhh.............eeeeeeee..eeeeeee.....ee.hhhhhhhhhhhhhhhhh..eeeeeee.....eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh....eeeeeeee..eeeeeeee......hhhhhh... ........hhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..KGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFK... ..RNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLYNEELVS... ..NVQGDYEPTDATGFININSLRLKEYHRLQS
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144         ... ..157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       ... ..378       388       398       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*     | |||   |        | |       |||| |           | |      | |             | |      ||||   |             | |    |||^**| |   |       |  |   || ||       |..PS00005..      |   | |  | ^**   |  || |       |  | |||  |  |  | || ||| |                 | || |   |  |           ||| |      | |||       |   |        | | ||| |        | |  |  |||||               |  |                   |  | || |   ..PS00005..   | |            ^**||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||   |        | |       |||| |           | |      | |             | |      ||||   |             | |    ||||  | |   |       |  |   || ||       |..PS00006..      |   | |  |  |    ^***| |       |  | |||  |  |  | || ||| |                 | || |   ^***           ||| |      | |||       |   |        | | ||| |        | |  |  |||||               |  |                   |  | || |   ..PS00006..   | |            |  ||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      | |||   |        | |       |||| |           | |      | |             | |      ||||   |             | |    ||||  | |   |       |  |   || ||       *..PS00007..******^   | |  |  |        | |       |  | |||  |  |  | || ||| |                 | || |                  ||| |      | |||       |   |        | | ||| |        | ******^||||               |  |                   |  | || |   ..PS00007..   | |            |  ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |^*****        | |       |||| |           | |      | |             | |      ||^*****             | |    ||||  | |   |       |  |   || ||        ..PS00008..          | |  |  |        | |       |  | |||  |  |  | || ||| |                 | || |                  ||| |      | |||       |   |        | | ||| |        ^*****   ||||               |  |                   |  | || |   ..PS00008..   | |            |  ||       
search RasMol script viewer Motif-ligand binding stats  ARGININOSUCCIN_SYN_1 ..      *********        | |       |||| |           | |      | |             | |      ||||   |             | |    ||||  | |   |       |  |   || ||        ..PS00564..          | |  |  |        | |       |  | |||  |  |  | || ||| |                 | || |                  ||| |      | |||       |   |        | | ||| |             |   ||||               |  |                   |  | || |   ..PS00564..   | |            |  ||       
search RasMol script viewer Motif-ligand binding stats  ARGININOSUCCIN_SYN_2 ..        | |   |        | |       |||| |           | |      | |             | |      ||||   |             | |    |************       |  |   || ||        ..PS00565..          | |  |  |        | |       |  | |||  |  |  | || ||| |                 | || |                  ||| |      | |||       |   |        | | ||| |             |   ||||               |  |                   |  | || |   ..PS00565..   | |            |  ||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |   |        | |       |||| |           | |      | |             | |      ||||   |             | |    | ||  | |           |  |   *****        ..alphabetamotif..          | |  |  |        | |       |  | |||  |  |  | *****| |                 | || |                  ||| |      | |||       |   |        | | ||| |             |   ||||               |  |                   |  | || |   ..alphabetamotif..   | |            *****       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | |   |        | |       |||| |           | |      | |             | |      ||||   |             | |    | ||  | |           |  |   || ||        ..asxmotif..          | |  |  |        | |       |  *****  |  |  | || ||| |                 | || |                  ||| |      | |||       |   |        | | ||| |             |   ||||               |  |                   |  | || |   ..asxmotif..   | |            |  |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |   |        | |       ***| |           | |      ***             | |      ||||   |             | |    | ||  | |           |  |   || ||        ..asxturn..          | |  |  |        ***       |  ***|   |  |  | || ||| |                 ******                  ||| |      | |||       |   |        | | ||***             |   ||||               |  |                   |  | |***   ..asxturn..   | |            |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |   |        | |        | | |           | |                      | |      ||||   |             | |    | ||  | |           |  |   *****        ..betaturn..          | |  |  |                  |  ****   |  |  | ****|| |                    | |                  ||| |      ****|       |   |        | | ||                |   ||||               ****                   |  | |      ..betaturn..   | |            ****        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |   |        | |        | | |           | |                      | |      ||||   |             | |    | ||  | |           |  |    |  |        ..gammaturn..          | |  |  |                  |  |  |   |  |  |  |  || |                    | |                  ||| |        | |       |   |        | | ||                |   ||||               |  |                   |  | |      ..gammaturn..   ***                        
search RasMol script viewer Motif-ligand binding stats  nest ..        ***   |        ***        *** |           ***                      ***      ****   |             ***    | ||  | |           |  |    |  |        ..nest..          ***  |  |                  |  |  |   |  |  |  |  || |                    ***                  *** |        ***       |   |        | | ||                |   ****               |  |                   |  | |      ..nest..                              
search RasMol script viewer Motif-ligand binding stats  niche ..          |   |                     ***                                    | |             |                    ******* |           ****    ****        ..niche..               ****                  *******   *******  *******                                          ****                  |   |        | ****                |   |                  ****                   ******      ..niche..                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****                                                            | |             |                            |                               ..ststaple..                                                                                                                               *****        *****                 *****                                            | |      ..ststaple..                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                           ***             |                            |                               ..stturn..                                                                                                                                                                                                                   ***      ..stturn..                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                           *                            *                               ..REP00000..                                                                                                                                                                                                                            ..REP00000..                              

   New search    2nz2:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors