triangle PDBeMotif: 2mx4  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification translation,protein binding    | release date: Wed, Dec 10, 2014
Title nmr structure of phosphorylated 4e-bp2
Authors A.BAH, C.ZHAO, J.FORMAN-KAY, L.KAY, M.KRZEMINSKI, N.SONENBERG, R.MUHAND, R.VERNON, Z.SIDDIQUI
Method SOLUTION NMR
PDBe Citation   
Modified residues:  search TPO TPO binding statistics TPO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || |||  |  | |^*****| |||            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *****|  |  | |||    | |||            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || |||  |  *****    *****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..        *****|  |  ****|    ****|            
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***            
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                            

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || |||  |  | |^*****| |||     |  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || |||  |  *****    *****     |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        *****|  |  ****|    ****|     ****   
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                     ****   

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  ||  |  | |^*****| |||     |  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  ||  |  *****    *****     |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|  |  ****|    ****|     ****   
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                     ****   

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || || | |  | |^*****| |||     |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        ***** | |  | |||    | |||     |  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || || | |  *****    *****     |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ***** | |  ****|    ****|     ****   
search RasMol script viewer Motif-ligand binding stats  nest ..         |  | | |    ***      ***     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..         **** ***                     ****   

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || |||  |  | |^*****| |||     | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *****|  |  | |||    | |||     | |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || |||  |  *****    *****     | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        *****|  |  ****|    ****|     | |    
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***     | |    
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                     ***    

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || ||      | |^*****| |||     |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *****      | |||    | |||     |  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || ||      *****    *****     |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****|      ****|    ****|     |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        ***      ***     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                         ****   

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || || | |  | |^*****| |||     |  | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || || | |  *****    *****     |  | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ***** | |  ****|    ****|     **** | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  | | |    ***      ***     |  | | 
search RasMol script viewer Motif-ligand binding stats  niche ..         **** ***                     ****** 

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || ||      | |^*****| |||     |  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || ||      *****    *****     |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        *****      ****|    ****|     |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        ***      ***     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                         ****   

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || ||      | |^*****| |||     |  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || ||      *****    *****     |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        *****      ****|    ****|     |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        ***      ***     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                         ****   

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || ||      | |^*****| |||     |  | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || ||      *****    *****     |  | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        *****      ****|    ****|     |  | | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        ***      ***     |  | | 
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                         ****** 

Assembly 1  model: 11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |      | |^*****| |||     |  | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  |      *****    | |||     |  | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****      ****|    ****|     |  | | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        ***      ***     |  | | 
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                         ****** 

Assembly 1  model: 12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || |||  |  | |^*****| |||     |  | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || |||  |  *****    *****     |  | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        *********  ****|    ****|     **** | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***     |  | | 
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                     ****** 

Assembly 1  model: 13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || || | |  | |^*****| |||     |  | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || || | |  *****    *****     |  | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ***** | |  ****|    ****|     **** | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  | ***    | |      | |     |  | | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        ***      ***     |  | | 
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                         ****** 

Assembly 1  model: 14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || ||      | |^*****| |||        | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || ||      *****    *****        | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****|      ****|    ****|        | | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        ***      ***        | | 
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                            *** 

Assembly 1  model: 15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ||| ||  |  | |^*****| |||     || ||| 
search RasMol script viewer Motif-ligand binding stats  asxturn ..        *** ||  |  | |||    | |||     || ||| 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  ||  |  *****    *****     || ||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|  |  ****|    ****|     |****| 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***     |  *** 
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                     |    | 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                      ****** 

Assembly 1  model: 16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  ||  |  | |^*****| |||     |  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  ||  |  *****    *****     |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|  |  ****|    ****|     |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                     ****   

Assembly 1  model: 17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ||| ||  |  | |^*****| |||            
search RasMol script viewer Motif-ligand binding stats  asxturn ..        *** ||  |  | |||    | |||            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  ||  |  *****    *****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|  |  ****|    ****|            
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***            
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                            

Assembly 1  model: 18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  ||  |  | |^*****| |||       |||| 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  ||  |  *****    *****       |||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|  |  ****|    ****|       |||| 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  ||  |    | |      | |       |*** 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***       | |  
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                       ***  

Assembly 1  model: 19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  ||  |  | |^*****| |||     |  | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  ||  |  *****    *****     |  | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|  |  ****|    ****|     |  | | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***     |  | | 
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                     ****** 

Assembly 1  model: 20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDI2;
member of: PANTHER:searchPTHR12669/searchPTHR12669_SF4PFAM:searchPF05456UniProt:searchQ13542
sec str:  ...eeeeee..........ee.....eeee.....eeeeee......
sequence :  ..PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR
seq num:  ..18        28        38        48        58   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  ||  |  | |^*****| |||    | ||| | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  ||  |  *****    *****    | ||| | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|  |  ****|    ****|    ****| | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  ||  |    ***      ***      *** | 
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                      ***** 

   New search    2mx4:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML