triangle PDBeMotif: 2mpf  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transport protein    | release date: Fri, May 16, 2014
Title solution structure human hcn2 cnbd in the camp-unbound state
Authors A.MORONI, A.SAPONARO, B.SANTORO, C.HAMMANN, F.CANTINI, G.THIEL, L., M.MATZAPETAKIS, S.R.PAULETA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GPSSPMELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK
GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | | ||  |  || || ||||  |     |  | |    || ||      |            | | ||| ||||  ||  |  | |                                      || **^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | | ||  |  || || ||||  |     |  | |    || ||      |            | | ||| ||||  ||  |  ^**                                      || ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | | ||  |  || || ||||  |     |  | |    || ||      |            | | ||| ||||  ||  |                                           || ||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | | ||  |  || || ||||  |     |  | |    || ||      |            ******^ ||||  ||  |                                           || ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | | ||  |  || || ||||  |     |  | |    || ||      |              | ^*****||  ||  |                                           || ||      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   | | ||  |  || || ||||  |     |  | |    |^***      |              |  |  | ||  |^***                                           |^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..   | | ||  |  || || ||||  |     |  | *****************              |  |  | ||  |                                               |  |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | ||  |  || ******|  |     |  |      |  |                      |  |  | ||  |                                               |  |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | | ||  |  |***| || |  |     |  |      |  |                      |  |  | ||  |                                               |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | ||  ****  ***** |  |     ****      |  |                      ****  | |****                                               ****       
search RasMol script viewer Motif-ligand binding stats  niche ..   | ****  ****        ****     ****      ****                      ****  *******                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****                                                                                                                                   

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   ||| ||  |  ||||||||||  |     |  | |    || ||      |     |  |   | | |||  | |  ||  |  | |                         |  ||  |  ||||| **^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||| ||  |  ||||||||||  |     |  | |    || ||      |     |  |   | | |||  | |  ||  |  ^**                         |  ||  |  ||||| ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||| ||  |  ||||||||||  |     |  | |    || ||      |     |  |   | | |||  | |  ||  |                              |  ||  |  ||||| ||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   ||| ||  |  ||||||||||  |     |  | |    || ||      |     |  |   ******^  | |  ||  |                              |  ||  |  ||||| ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ||| ||  |  ||||||||||  |     |  | |    || ||      |     |  |     | ^***** |  ||  |                              |  ||  |  ||||| ||      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   ||| ||  |  ||||||||||  |     |  | |    |^***      |     |  |     |  |     |  |^***                              |  ||  |  ||||^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..   ||| ||  |  ||||||||||  |     |  | *****************     |  |     |  |     |  |                                  |  ||  |  ||||| |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||| ||  |  |||******|  |     |  |      |  |             |  |     |  |     |  |                                  *****  *****||| |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   ||| ||  |  |*****|| |  |     |  |      |  |             |  |     |  |     |  |                                  |  |   |  | ||| |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |****|  |  | |***** |  |     ****      |  |             ****     ****     |  |                                  ****   **** ||| |       
search RasMol script viewer Motif-ligand binding stats  niche ..   | ****  **** |   |  ****     ****      ****                      ****     ****                                            *******       
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****        *****                                                                                                                      

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | ||| ||  |  ||||| || |  |     |  ||||   || ||      |            | | |||  |     |  |  | |           |  ||     |  |  ||          | **^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||| ||  |  ||||| || |  |     |  ||||   || ||      |            | | |||  |     |  |  ^**           |  ||     |  |  ||          |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ||| ||  |  ||||| || |  |     |  ||||   || ||      |            | | |||  |     |  |                |  ||     |  |  ||          |  |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | ||| ||  |  ||||| || |  |     |  ||||   || ||      |            ******^  |     |  |                |  ||     |  |  ||          |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | ||| ||  |  ||||| || |  |     |  ||||   || ||      |              | ^*****     |  |                |  ||     |  |  ||          |  |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | ||| ||  |  ||||| || |  |     |  ||||   |^***      |              |  |         ^***                |  ||     |  |  ||          ^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 .. | ||| ||  |  ||||| || |  |     |  ||*****************              |  |                             |  ||     |  |  ||          |  |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | ||| ||  |  |||***** |  |     |  || |   |  |                      |  |                             *****     |  *****          |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn .. | ||| ||  |  |***| || |  |     |  || |   |  |                      |  |                             |  |      |  |  |           |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****| ||  **** |***** |  |     ****| |   |  |                      ****                             ****      *******           |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..   | ****  **** |   |  ****     *******   ****                      ****                                                         ****      
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****        *****                                                                                                                      

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|| ||| ||  |  ||||  |  |  |     |  | |    || ||    |||     |  |   | | |||  | |  ||  |  | |                         |  || |  || | | **^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| ||| ||  |  ||||  |  |  |     |  | |    || ||    |||     |  |   | | |||  | |  ||  |  ^**                         |  || |  || | | ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| ||| ||  |  ||||  |  |  |     |  | |    || ||    |||     |  |   | | |||  | |  ||  |                              |  || |  || | | ||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|| ||| ||  |  ||||  |  |  |     |  | |    || ||    |||     |  |   ******^  | |  ||  |                              |  || |  || | | ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|| ||| ||  |  ||||  |  |  |     |  | |    || ||    |||     |  |     | ^***** |  ||  |                              |  || |  || | | ||      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|| ||| ||  |  ||||  |  |  |     |  | |    |^***    |||     |  |     |  |     |  |^***                              |  || |  || | ^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..|| ||| ||  |  ||||  |  |  |     |  | *****************     |  |     |  |     |  |                                  |  || |  || | | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|| ||| ||  |  ||||  |  |  |     |  |      |  |     ||      |  |     |  |     |  |                                  ***** ***** | | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..|| ||| ||  |  |***  |  |  |     |  |      |  |     ||      |  |     |  |     |  |                                  |  |  |  |  | | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..|| ||| ||  |  | ||  |  |  |     |  |      |  |     **      |  |     |  |     |  |                                  |  |  |  |  | | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..************  | |****  |  |     ****      |  |             ****     ****     ****                                  ****  ****  | | |       
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |  |  | |   |  |  |     |  |      |  |                      |  |     |  |                                           |  | ***       
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  **** |   |  ****     ****      ****                      ****     ****                                           ****           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                                                                                      

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | | |  |  |  || |  |  |  |     |  | |    || ||    |||     |  |   | | |||  | |||||  |  | |             |  |    |  |    | || ||   | **^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | | |  |  |  || |  |  |  |     |  | |    || ||    |||     |  |   | | |||  | |||||  |  ^**             |  |    |  |    | || ||   |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | | |  |  |  || |  |  |  |     |  | |    || ||    |||     |  |   | | |||  | |||||  |                  |  |    |  |    | || ||   |  |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | | |  |  |  || |  |  |  |     |  | |    || ||    |||     |  |   ******^  | |||||  |                  |  |    |  |    | || ||   |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | | |  |  |  || |  |  |  |     |  | |    || ||    |||     |  |     | ^***** |||||  |                  |  |    |  |    | || ||   |  |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | | |  |  |  || |  |  |  |     |  | |    |^***    |||     |  |     |  |     ||||^***                  |  |    |  |    | || ||   ^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 .. | | |  |  |  || |  |  |  |     |  | *****************     |  |     |  |     ||||                      |  |    |  |    | || ||             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | | |  |  |  || |  |  |  |     |  |      |  |     ||      |  |     |  |     ||||                      |  |    |  |    | *****             
search RasMol script viewer Motif-ligand binding stats  asxturn .. | | |  |  |  |***  |  |  |     |  |      |  |     ||      |  |     |  |     ||||                      |  |    |  |    | || |              
search RasMol script viewer Motif-ligand binding stats  betabulge .. | | |  |  |  |  |  |  |  |     |  |      |  |     **      |  |     |  |     ||||                      |  |    |  |    | || |              
search RasMol script viewer Motif-ligand binding stats  betaturn .. | | |  |  |  |  **********     ****      |  |             ****     ****     ||||                      ****    ****    ******              
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | | |  |  |  |        |  |     |  |      |  |                      |  |     ***|                                                          
search RasMol script viewer Motif-ligand binding stats  nest .. *** |  |  |  |        |  |     |  |      |  |                      |  |      | |                                                          
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  ****        ****     ****      ****                      ****      ***                                                          

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | | ||| || ||||  |  |  |     |  ||||   || ||    |||     |  |   | | ||| ||||  ||  |  | |          | |            |  ||    |  | | **^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | | ||| || ||||  |  |  |     |  ||||   || ||    |||     |  |   | | ||| ||||  ||  |  ^**          | |            |  ||    |  | | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | | ||| || ||||  |  |  |     |  ||||   || ||    |||     |  |   | | ||| ||||  ||  |               | |            |  ||    |  | | || |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | | ||| || ||||  |  |  |     |  ||||   || ||    |||     |  |   ******^ ||||  ||  |               | |            |  ||    |  | | || |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | | ||| || ||||  |  |  |     |  ||||   || ||    |||     |  |     | ^*****||  ||  |               | |            |  ||    |  | | || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   | | ||| || ||||  |  |  |     |  ||||   |^***    |||     |  |     |  |  | ||  |^***               | |            |  ||    |  | ^*** |    
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..   | | ||| || ||||  |  |  |     |  ||*****************     |  |     |  |  | ||  |                   | |            |  ||    |  | | || |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | ||| || ||||  |  |  |     |  || |   |  |     ||      |  |     |  |  | ||  |                   | |            *****    |  | | || |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | | ||| || |***  |  |  |     |  || |   |  |     ||      |  |     |  |  | ||  |                   | |            |  |     |  | | || |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | | ||| || | |   |  |  |     |  || |   |  |     **      |  |     |  |  | ||  |                   | |            |  |     |  | | || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | ||**** | |   *******     ****| |   |  |             ****     ****  | |****                   | |            ****     |  | | || |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | | ||  |  | |   |  |  |     |  || |   |  |                      |  |  ***|  |                   | |                     |  | | || |    
search RasMol script viewer Motif-ligand binding stats  niche ..   | ****  **** |   |  ****     *******   ****                      ****     ****                   | |                     **** ******    
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****        *****                                                                               | |                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    ***                                    

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| | || ||  |  ||||| || |  |     |  | |    || ||      |            | | |||  |||  ||  |  | |          | |                          | **^*|   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| | || ||  |  ||||| || |  |     |  | |    || ||      |            | | |||  |||  ||  |  ^**          | |                          | ||  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| | || ||  |  ||||| || |  |     |  | |    || ||      |            | | |||  |||  ||  |               | |                          | ||  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| | || ||  |  ||||| || |  |     |  | |    || ||      |            ******^  |||  ||  |               | |                          | ||  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| | || ||  |  ||||| || |  |     |  | |    || ||      |              | ^*****||  ||  |               | |                          | ||  |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..| | || ||  |  ||||| || |  |     |  | |    |^***      |              |  |    ||  |^***               | |                          ^***  |   
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..| | || ||  |  ||||| || |  |     |  | *****************              |  |    ||  |                   | |                          | ||  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..*** || ||  |  |***| || |  |     |  |      |  |                      |  |    ||  |                   | |                          | ||  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|  |  | |***** ****     ****      ****                      |  |    ||  |                   | |                          | |****   
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  **** |   |  ****     ****      ****                      ****    |****                   | |                          *******   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                       *****                   | |                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    ***                                    

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  ||  |  |  ||||| || |  |     |  | |    || ||      |            | | |||  | | | |  |  | |                                    |  ||**^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  ||  |  |  ||||| || |  |     |  | |    || ||      |            | | |||  | | | |  |  ^**                                    |  || |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  ||  |  |  ||||| || |  |     |  | |    || ||      |            | | |||  | | | |  |                                         |  || |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  ||  |  |  ||||| || |  |     |  | |    || ||      |            ******^  | | | |  |                                         |  || |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  ||  |  |  ||||| || |  |     |  | |    || ||      |              | ^***** | | |  |                                         |  || |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. |  ||  |  |  ||||| || |  |     |  | |    |^***      |              |  |     | | ^***                                         |  ^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 .. |  ||  |  |  ||||| || |  |     |  | *****************              |  |     | |                                              |  || |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****  |  |  ||||| || |  |     |  |      |  |                      |  |     | |                                              |  || |      
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  ||  |  |  |***| || |  |     |  |      |  |                      |  |     | |                                              |  || |      
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|  ******* | **** |  |     ****      |  |                      ****     | |                                              ****| |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |  |  | |   |  |  |     |  |      |  |                      |  |     ***                                                  | |      
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |  |  | |   |  |  |     |  |      |  |                      |  |                                                          ***      
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  **** |   |  ****     ****      ****                      ****                                                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                                                                                      

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |  || || |   | || |  |     |  | |  | || ||      |            | | |||  | |  ||  |  | |                               |  ||  |||**^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  || || |   | || |  |     |  | |  | || ||      |            | | |||  | |  ||  |  ^**                               |  ||  ||||||     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  || || |   | || |  |     |  | |  | || ||      |            | | |||  | |  ||  |                                    |  ||  ||||||     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  || || |   | || |  |     |  | |  | || ||      |            ******^  | |  ||  |                                    |  ||  ||||||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  || || |   | || |  |     |  | |  | || ||      |              | ^***** |  ||  |                                    |  ||  ||||||     
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..     |  || || |   | || |  |     |  | |  | |^***      |              |  |     |  |^***                                    |  ||  |^***|     
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..     |  || || |   | || |  |     |  | *****************              |  |     |  |                                        |  ||  | || |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  || || |   | || |  |     |  |    | |  |                      |  |     |  |                                        *****  | || |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |******   *********     |  |    | ****                      ****     ****                                        ****   | || |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |  |  |        |  |     |  |    | |  |                      |  |     |  |                                               ***| |     
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  ****        ****     ****    ******                      ****     ****                                                  ***     

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    || ||  |  ||||| || |  |     |  | |    || ||      |     |  |   | | |||| | | | |  |  | |             |  ||    |  ||    |  ||| || **^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    || ||  |  ||||| || |  |     |  | |    || ||      |     |  |   | | |||| | | | |  |  ^**             |  ||    |  ||    |  ||| ||  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    || ||  |  ||||| || |  |     |  | |    || ||      |     |  |   | | |||| | | | |  |                  |  ||    |  ||    |  ||| ||  |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    || ||  |  ||||| || |  |     |  | |    || ||      |     |  |   ******^| | | | |  |                  |  ||    |  ||    |  ||| ||  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    || ||  |  ||||| || |  |     |  | |    || ||      |     |  |     | ^***** | | |  |                  |  ||    |  ||    |  ||| ||  |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    || ||  |  ||||| || |  |     |  | |    |^***      |     |  |     |  | | | | | ^***                  |  ||    |  ||    |  ||| |^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..    || ||  |  ||||| || |  |     |  | *****************     |  |     |  | | | | |                       |  ||    |  ||    |  ||| ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    || ||  |  |||***** |  |     |  |      |  |             |  |     |  | | | | |                       *****    *****    *****| ||         
search RasMol script viewer Motif-ligand binding stats  asxturn ..    || ||  |  |***| || |  |     |  |      |  |             |  |     |  | | | | |                       |  |     |  |     |  ||| ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|  |  | |***** ****     |  |      |  |             ****     **** | | | |                       ****     ****     ********|         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |  |  | |   |  |  |     |  |      |  |                      |  | | | ***                                              |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  **** |   |  ****     ****      ****                      **** ***                                                  ****         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                                                                                      

Assembly 1  model: 11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  ||  |  |  ||||| ||||  |     |  | |     |  |      |            | | |||  | | | |  |  | |          | |           |  |          |||**^*|   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  ||  |  |  ||||| ||||  |     |  | |     |  |      |            | | |||  | | | |  |  ^**          | |           |  |          ||| || |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  ||  |  |  ||||| ||||  |     |  | |     |  |      |            | | |||  | | | |  |               | |           |  |          ||| || |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  ||  |  |  ||||| ||||  |     |  | |     |  |      |            ******^  | | | |  |               | |           |  |          ||| || |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  ||  |  |  ||||| ||||  |     |  | |     |  |      |              | ^***** | | |  |               | |           |  |          ||| || |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. |  ||  |  |  ||||| ||||  |     |  | |     ^***      |              |  |     | | ^***               | |           |  |          |^***| |   
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 .. |  ||  |  |  ||||| ||||  |     |  | *****************              |  |     | |                    | |           |  |          | |  | |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****  |  |  ||||*****|  |     |  |                                |  |     | |                    | |           |  |          | |  | |   
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  ||  |  |  |***| || |  |     |  |                                |  |     | |                    | |           |  |          | |  ***   
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|  |  |  | | **** |  |     |  |                                ****     | |                    | |           ****          | |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |  |  | |   |  |  |     |  |                                |  |     ***                    | |                         | |        
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |  |  | |   |  |  |     |  |                                |  |                            | |                         ***        
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  **** |   |  ****     ****                                ****                            | |                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                                               | |                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    ***                                    

Assembly 1  model: 12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |  |  |  ||||| ||||  |     |  ||||   || ||    |||     |  |   | | |||  |  | ||  |  | |             |  ||           |  |||  ||||**^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |  |  ||||| ||||  |     |  ||||   || ||    |||     |  |   | | |||  |  | ||  |  ^**             |  ||           |  |||  |||| |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |  |  ||||| ||||  |     |  ||||   || ||    |||     |  |   | | |||  |  | ||  |                  |  ||           |  |||  |||| |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |  |  ||||| ||||  |     |  ||||   || ||    |||     |  |   ******^  |  | ||  |                  |  ||           |  |||  |||| |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |  |  ||||| ||||  |     |  ||||   || ||    |||     |  |     | ^*****  | ||  |                  |  ||           |  |||  |||| |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..     |  |  |  ||||| ||||  |     |  ||||   |^***    |||     |  |     |  |      | |^***                  |  ||           |  |||  ||^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..     |  |  |  ||||| ||||  |     |  ||*****************     |  |     |  |      | |                      |  ||           |  |||  || |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |  |  |||******|  |     |  || |   |  |     ||      |  |     |  |      | |                      *****           *****|  || |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |  |  |***| || |  |     |  || |   |  |     ||      |  |     |  |      | |                      |  |            |  | |  || |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..     |  |  |  | ||| || |  |     |  || |   |  |     **      |  |     |  |      | |                      |  |            |  | |  || |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |  **** |***** |  |     ****| |   ****             ****     |  |      | |                      ****            **** ****| |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |  |  | |   |  |  |     |  || |   |  |                      |  |      | |                                               ***        
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |  |  | |   |  |  |     |  || |   |  |                      |  |      | |                                               ***        
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  **** |   |  ****     *******   ****                      ****      ***                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                                                                                      

Assembly 1  model: 13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | ||| ||  |  ||||| ||||  |     |  ||||   || ||      |     |  |   | | |||  |  | ||  |  | |          |   |  ||               |  ||| **^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||| ||  |  ||||| ||||  |     |  ||||   || ||      |     |  |   | | |||  |  | ||  |  ^**          |   |  ||               |  ||| ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ||| ||  |  ||||| ||||  |     |  ||||   || ||      |     |  |   | | |||  |  | ||  |               |   |  ||               |  ||| ||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | ||| ||  |  ||||| ||||  |     |  ||||   || ||      |     |  |   ******^  |  | ||  |               |   |  ||               |  ||| ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | ||| ||  |  ||||| ||||  |     |  ||||   || ||      |     |  |     | ^*****  | ||  |               |   |  ||               |  ||| ||      
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | ||| ||  |  ||||| ||||  |     |  ||||   |^***      |     |  |     |  |      | |^***               |   |  ||               |  ||^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 .. | ||| ||  |  ||||| ||||  |     |  ||*****************     |  |     |  |      | |                   |   |  ||               |  ||  |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ***** ||  |  |||******|  |     |  || |   |  |             |  |     |  |      | |                   |   *****               |  ||  |       
search RasMol script viewer Motif-ligand binding stats  asxturn .. | ||| ||  |  |***| || |  |     |  || |   |  |             |  |     |  |      | |                   |   |  |                |  ||  |       
search RasMol script viewer Motif-ligand binding stats  betaturn .. *******|  |  | |***** |  |     ****| |   |  |             ****     ****      | |                   |   ****                |  |****       
search RasMol script viewer Motif-ligand binding stats  niche ..   | ****  **** |   |  ****     *******   ****                      ****      ***                   |   |                   ****           
search RasMol script viewer Motif-ligand binding stats  stmotif ..   |   |        |   |                                                                               *****                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****        *****                                                                                                                      

Assembly 1  model: 14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | ||| ||  |  ||||  |  |  |     |  | |    || ||    |||     |  |   | | |||  |     |  |  | |                        |  ||          ||**^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||| ||  |  ||||  |  |  |     |  | |    || ||    |||     |  |   | | |||  |     |  |  ^**                        |  ||          || |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ||| ||  |  ||||  |  |  |     |  | |    || ||    |||     |  |   | | |||  |     |  |                             |  ||          || |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | ||| ||  |  ||||  |  |  |     |  | |    || ||    |||     |  |   ******^  |     |  |                             |  ||          || |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | ||| ||  |  ||||  |  |  |     |  | |    || ||    |||     |  |     | ^*****     |  |                             |  ||          || |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | ||| ||  |  ||||  |  |  |     |  | |    |^***    |||     |  |     |  |         ^***                             |  ||          ^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 .. | ||| ||  |  ||||  |  |  |     |  | *****************     |  |     |  |                                          |  ||           | |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |*****  |  ||||  |  |  |     |  |      |  |     ||      |  |     |  |                                          *****           | |      
search RasMol script viewer Motif-ligand binding stats  asxturn .. | ||| ||  |  |***  |  |  |     |  |      |  |     ||      |  |     |  |                                          |  |            | |      
search RasMol script viewer Motif-ligand binding stats  betabulge .. | ||| ||  |  | ||  |  |  |     |  |      |  |     **      |  |     |  |                                          |  |            | |      
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |****|  **** |****  |  |     ****      |  |             ****     ****                                          ****            | |      
search RasMol script viewer Motif-ligand binding stats  nest .. *** |  |  |  | |   |  |  |     |  |      |  |                      |  |                                                          ***      
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  **** |   |  ****     ****      ****                      ****                                                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                                                                                      

Assembly 1  model: 15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |  |  |  || || ||||  |     |  | |     |  |    |||     |  |   | | |||  |||| ||  |  | |                     |  |         |  | ||**^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |  |  || || ||||  |     |  | |     |  |    |||     |  |   | | |||  |||| ||  |  ^**                     |  |         |  | |||| |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |  |  || || ||||  |     |  | |     |  |    |||     |  |   | | |||  |||| ||  |                          |  |         |  | |||| |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |  |  || || ||||  |     |  | |     |  |    |||     |  |   ******^  |||| ||  |                          |  |         |  | |||| |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |  |  || || ||||  |     |  | |     |  |    |||     |  |     | ^*****||| ||  |                          |  |         |  | |||| |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..     |  |  |  || || ||||  |     |  | |     ^***    |||     |  |     |  |   |||| |^***                          |  |         |  | ^*** |    
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..     |  |  |  || || ||||  |     |  | *****************     |  |     |  |   |||| |                              |  |         |  | |||| |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |  |  || ******|  |     |  |               ||      |  |     |  |   |||| |                              |  |         |  | |||| |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |  |  |***| || |  |     |  |               ||      |  |     |  |   |||| |                              |  |         |  | |||| |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..     |  |  |  |  || || |  |     |  |               **      |  |     |  |   |||| |                              |  |         |  | |||| |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |  ****  ***** ****     ****                       ****     ****   |||| |                              ****         |  | ||****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |  |  |        |  |     |  |                                |  |   **** |                                           |  | |||| |    
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |  |  |        |  |     |  |                                |  |     |  |                                           |  | |*** |    
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  ****        ****     ****                                ****     ****                                           ***********    

Assembly 1  model: 16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | | ||  |  | ||| || |  |     |  ||||   || ||    |||            | | |||  | |  ||  |  | |            |||||||     |  ||         |||**^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | | ||  |  | ||| || |  |     |  ||||   || ||    |||            | | |||  | |  ||  |  ^**            |||||||     |  ||         ||| |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | | ||  |  | ||| || |  |     |  ||||   || ||    |||            | | |||  | |  ||  |                 |||||||     |  ||         ||| |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | | ||  |  | ||| || |  |     |  ||||   || ||    |||            ******^  | |  ||  |                 |||||||     |  ||         ||| |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | | ||  |  | ||| || |  |     |  ||||   || ||    |||              | ^***** |  ||  |                 |||||||     |  ||         ||| |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   | | ||  |  | ||| || |  |     |  ||||   |^***    |||              |  |     |  |^***                 |||||||     |  ||         |^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..   | | ||  |  | ||| || |  |     |  ||*****************              |  |     |  |                     |||||||     |  ||         | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | ||  |  | |***** |  |     |  || |   |  |     ||               |  |     |  |                     *******     *****         | |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | | ||  |  | ||| || |  |     |  || |   |  |     **               |  |     |  |                     ||||||      |  |          | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | |****  | |*******  |     ****| |   ****                      ****     ****                     ******      ****          | |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | | ||  |  | |   |  |  |     |  || |   |  |                      |  |     |  |                                               ***        
search RasMol script viewer Motif-ligand binding stats  niche ..   | ****  **** |   |  ****     *******   ****                      ****     ****                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****        *****                                                                                                                      

Assembly 1  model: 17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |  |  |  ||||| ||||  |     |  | |    || ||      |     |  |   | | |||  | |  ||  |  | |                     |  |         |  ||||**^*| | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |  |  ||||| ||||  |     |  | |    || ||      |     |  |   | | |||  | |  ||  |  ^**                     |  |         |  |||||| || | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |  |  ||||| ||||  |     |  | |    || ||      |     |  |   | | |||  | |  ||  |                          |  |         |  |||||| || | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |  |  ||||| ||||  |     |  | |    || ||      |     |  |   ******^  | |  ||  |                          |  |         |  |||||| || | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |  |  ||||| ||||  |     |  | |    || ||      |     |  |     | ^***** |  ||  |                          |  |         |  |||||| || | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..     |  |  |  ||||| ||||  |     |  | |    |^***      |     |  |     |  |     |  |^***                          |  |         |  ||^*** || | 
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..     |  |  |  ||||| ||||  |     |  | *****************     |  |     |  |     |  |                              |  |         |  || ||| || | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |  |  |||******|  |     |  |      |  |             |  |     |  |     |  |                              |  |         |  || ||| || | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |  |  |***| || |  |     |  |      |  |             |  |     |  |     |  |                              |  |         |  || ||| || | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |  **** |***** |  |     ****      |  |             ****     ****     |  |                              ****         |  |****| || | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |  |  | |   |  |  |     |  |      |  |                      |  |     |  |                                           |  |*** | || | 
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |  |  | |   |  |  |     |  |      |  |                      |  |     |  |                                           |  |*** | || | 
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  **** |   |  ****     ****      ****                      ****     ****                                           ****    ****** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                                                                                      

Assembly 1  model: 18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   ||| ||  |  | | | || |  |     |  | |     |  |    |||     |  |   | | ||| ||||  ||  |  | |          | || ||         |  |         | **^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||| ||  |  | | | || |  |     |  | |     |  |    |||     |  |   | | ||| ||||  ||  |  ^**          | || ||         |  |         |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||| ||  |  | | | || |  |     |  | |     |  |    |||     |  |   | | ||| ||||  ||  |               | || ||         |  |         |  |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   ||| ||  |  | | | || |  |     |  | |     |  |    |||     |  |   ******^ ||||  ||  |               | || ||         |  |         |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ||| ||  |  | | | || |  |     |  | |     |  |    |||     |  |     | ^*****||  ||  |               | || ||         |  |         |  |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   ||| ||  |  | | | || |  |     |  | |     ^***    |||     |  |     |  |  | ||  |^***               | || ||         |  |         ^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..   ||| ||  |  | | | || |  |     |  | *****************     |  |     |  |  | ||  |                   | || ||         |  |                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||| ||  |  | | | || |  |     |  |               ||      |  |     |  |  | ||  |                   | *****         |  |                   
search RasMol script viewer Motif-ligand binding stats  betabulge ..   ||| ||  |  | | | || |  |     |  |               **      |  |     |  |  | ||  |                   | || ||         |  |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |****|  |  | | ******  |     ****                       ****     ****  | |****                   | *****         ****                   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | | ||  |  | |   |  |  |     |  |                                |  |  ***|  |                   | |                                    
search RasMol script viewer Motif-ligand binding stats  niche ..   | ****  **** |   |  ****     ****                                ****  *******                   | |                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****        *****                                                                               | |                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    ***                                    

Assembly 1  model: 19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    || ||  |  ||||| || |  |     |  | |     |  |    |||     | ||   | | |||  | |  ||| |  | |                             | ||||| | | **^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    || ||  |  ||||| || |  |     |  | |     |  |    |||     | ||   | | |||  | |  ||| |  ^**                             | ||||| | | |||     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    || ||  |  ||||| || |  |     |  | |     |  |    |||     | ||   | | |||  | |  ||| |                                  | ||||| | | |||     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    || ||  |  ||||| || |  |     |  | |     |  |    |||     | ||   ******^  | |  ||| |                                  | ||||| | | |||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    || ||  |  ||||| || |  |     |  | |     |  |    |||     | ||     | ^***** |  ||| |                                  | ||||| | | |||     
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    || ||  |  ||||| || |  |     |  | |     ^***    |||     | ||     |  |     |  |^***                                  | ||||| | ^***|     
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 ..    || ||  |  ||||| || |  |     |  | *****************     | ||     |  |     |  | | |                                  | ||||| | | | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    || ||  |  ||||| || |  |     |  |               ||      | ||     |  |     |  | | |                                  ******* | | | |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..    || ||  |  |***| || |  |     |  |               ||      | ||     |  |     |  | | |                                  | || |  | | | |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..    || ||  |  | | | || |  |     |  |               **      | ||     |  |     |  | | |                                  | || |  | | | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ********  | | **** |  |     |  |                       ****     ****     **** | |                                  ******  | | | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |  |  | |   |  |  |     |  |                       ***      |  |     |  | ***                                       |  | | | |     
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  **** |   |  ****     ****                                ****     ****                                           ****** ***     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                                                                                      

Assembly 1  model: 20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLNUCLEOTIDE-GATED CHANNEL 2;
member of: GENE3D:searchG3DSA_1.10.287.630/searchG3DSA_2.60.120.10PANTHER:searchPTHR10217/searchPTHR10217_SF372PFAM:searchPF00027PRINTS:searchEAGCHANLFMLYPROSITE PATTERNS:searchPS00888, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchQ9UL51
sec str:  ...hhhhhh...hhhhhhhhhhhhhhhhheeeee....eee........eeeeee.eeeee.....eeeee...ee.............eeee...eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhh.............
sequence :  ..NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
seq num:  ..534       544       554       564       574       584       594       604       614       624       634       644       654       664      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | ||||||  |  || |     |  |     |  | |    || ||      |     |  |   | | |||  | |  ||  |  | |          | | |  || ||  | |  |       | ||**^*    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||||||  |  || |     |  |     |  | |    || ||      |     |  |   | | |||  | |  ||  |  ^**          | | |  || ||  | |  |       | || |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ||||||  |  || |     |  |     |  | |    || ||      |     |  |   | | |||  | |  ||  |               | | |  || ||  | |  |       | || |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | ||||||  |  || |     |  |     |  | |    || ||      |     |  |   ******^  | |  ||  |               | | |  || ||  | |  |       | || |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | ||||||  |  || |     |  |     |  | |    || ||      |     |  |     | ^***** |  ||  |               | | |  || ||  | |  |       | || |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | ||||||  |  || |     |  |     |  | |    |^***      |     |  |     |  |     |  |^***               | | |  || ||  | |  |       | ^***      
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 .. | ||||||  |  || |     |  |     |  | *****************     |  |     |  |     |  |                   | | |  || ||  | |  |       |  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****|||  |  || |     |  |     |  |      |  |             |  |     |  |     |  |                   | | ***** ||  | |  |       |  |        
search RasMol script viewer Motif-ligand binding stats  asxturn .. | ||||||  |  |***     |  |     |  |      |  |             |  |     |  |     |  |                   | | |  |  ||  | |  |       |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn .. ******|*******        |  |     ****      |  |             ****     ****     ****                   | | *********** ****       |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..   | ****  ****        ****     ****      ****                      ****     ****                   | |                        ****        
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****                                                                                            | |                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    ***                                    

   New search    2mpf:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML