triangle PDBeMotif: 2mkj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification translation regulator    | release date: Fri, Feb 7, 2014
Title solution structure of tandem rrm domains of cytoplasmic polyadenylation element binding protein 4 (cpeb4) in free s
Authors E.BELLOC, F.H.-T.ALL, J.G.BOIXET, L.SKRISOVSKA, R.MENDEZ, T.AFROZ
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEED
GKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELK
YPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |   | |     | ||| |||| |                  | |      | |                  | |  |||||       ^***||   | ||  |||||  |  ||  |       |  ||| ||   |  || || |             |  || | |   | |   || |    | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**   | |     | ||| ^**| |                  | |      | |                  | |  ^**||       | | ||   | ||  |||||  |  ||  |       |  ||| ||   |  || || |             |  || ^**   | |   || |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |   | |     | ||| || | |                  | |      | |                  | |  ^***|       | ^***   | ||  |||||  |  ||  |       |  ||| ||   |  ^***| |             |  ||       | |   || |    | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | |   | |     | ||| || | |                  | |      | |                  | |   |  |       | | ||   | ||  |||||  |  ||  |       |  ||| ||   |   | || |             |  ||       | |   |*******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |   | |     | ||| || | |                  | |      | |                  | |   |  |       | | ||   | ||  |||||  |  ||  |       |  ||| ^*****   | || |             |  ||       | |   |  |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |   | |     | ||| || | |                  | |      | |                  | |   |  |       | | ||   | ||  |||||  |  ||  |       *****|  |       | || |             *****       | |   |  |      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |   | |     | ||| || | |                  | |      | |                  | |   |  |       | | ||   | ||  *****  |  ||  |       |  | |  |       | || |             |  |        | |   |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |   | |     | ||| || | |                  | |      ***                  | |   |  |       | | ||   ***|  ***||  |  ||  |       |  | |  |       ***| |             |  |        | |   |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |   | |     | |****| | |                  | |                           | |   |  |       | | ||   |  |  ****|  |  ||  |       **** |  |          | |             ****        | |   |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..           | |   | |     | | | || ***                  | |                           | |   |  |       | | ||   |  |  ||  |  |  ||  |            |  |          ***                         ***   |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..           ***   ***     | | ****                      ***                           ***   ****       | ****   ****  |****  ********            ****                                            ****      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *******                                                                      *****          *****                                                                                

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |   | ||  ||| ||| |||  | |      |  |     |  |                           | |  | |||       ^*** |         |||||  |  |     | |          |    |  || || |        | |  |  || | |     || | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**   | ||  ||| ||| ^**  | |      |  |     |  |                           | |  ^**||         |  |         |||||  |  |     | |          |    |  || || |        | |  |  || ^**     || | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |   | ||  ||| ||| ||   | |      |  |     |  |                           | |  ^***|         ^***         |||||  |  |     | |          |    |  ^***| |        | |  |  ||         || | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | |   | ||  ||| ||| ||   | |      |  |     |  |                           | |    | |                      |||||  |  |     | |          |    |   | || |        | |  |  ||         || | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |   | ||  ||| ||| ||   | |      |  |     |  |                           | |    | |                      |||||  |  |     | |          ^*****   | || |        | |  |  ||         || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |   | ||  |*****| ||   | |      |  |     |  |                           | |    | |                      |||||  |  |     | |                   | || |        | |  *****         || |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |   | ||  ||| ||| ||   | |      |  |     |  |                           | |    | |                      *****  |  |     | |                   | || |        | |  |  |          || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |   | ||  ||| ||| ||   | |      |  |     |  |                           | |    | |                      ***||  |  |     | |                   ***| |        | |  |  |          || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |   | ||  |********|   | |      |  |     ****                           | |    | |                      ****|  |  |     | |                      | |        | |  ****          ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |   | ||  | | | | ||   | |      |  |                                    | |    | |                       |  |  |  |     | |                      | |        ***                 | |          
search RasMol script viewer Motif-ligand binding stats  nest ..           | |   | ||  | | | | ||   | |      |  |                                    | |    ***                       |  |  |  |     ***                      ***                            | |          
search RasMol script viewer Motif-ligand binding stats  niche ..           ***   ******* | | ****   ***      ****                                    ***                              ****  ****                                                             ***          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *******                                                                                                                                                                          

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   ||| |   | |   | ||  ||||||| | |        | || |                       || ||              | ||        ^***||   | |   |||||  |  | | |       |  ||  |    |  || |           | |  |  || | |     || | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||| |   ^**   | ||  ||||||| ^**        | || |                       || ||              ^**|        | ||||   | |   |||||  |  | | |       |  ||  |    |  || |           | |  |  || ^**     || | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||| |   | |   | ||  ||||||| |          | || |                       || ||              ^***        | ^***   | |   |||||  |  | | |       |  ||  |    |  ^***           | |  |  ||         || | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   ||| |   | |   | ||  ||||||| |          | || |                       || ||                          |  |||   | |   |||||  |  | | |       |  ||  |    |   | |           | |  |  ||         || | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ||| |   | |   | ||  ||||||| |          | || |                       || ||                          |  |||   | |   |||||  |  | | |       |  ||  ^*****   | |           | |  |  ||         || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||| |   | |   | ||  |*****| |          | || |                       || ||                          *****|   | |   |||||  |  | | |       *****           | |           | |  *****         || |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   ||| |   | |   | ||  |*****| |          | || |                       || ||                          |  | |   | |   *****  |  | | |       |  |            | |           | |  |  |          || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ||| |   | |   | ||  |***||| |          | || |                       || ||                          |  | |   ***   ***||  |  | | |       |  |            ***           | |  |  |          || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ||| |   | |   | ||  |********          **** |                       ****|                          **** |         ****|  |  | | |       ****                          | |  ****          ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ||| |   | |   | ||  | | | | |            |  |                        |  |                             | |         ||  |  |  | ***                                     ***                 | |          
search RasMol script viewer Motif-ligand binding stats  nest ..   *** |   | |   | ||  | | | | |            |  |                        |  |                             | |         ||  |  |  |                                                             | |          
search RasMol script viewer Motif-ligand binding stats  niche ..    ****   ***   ******* | | | |            ****                        ****                             ***         |****  ****                                                             ***          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *******                                                                                     *****                                                                                

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | | |  | || |          |  ||| ||| |      || || |     |  |                                | ||        ^***||   | ||  |||||          ||||        | ||   |  || || |        | |  | ||| | |     || | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | | |  | |^**          |  ||| ^** |      || || |     |  |                                ^**|        | ||||   | ||  |||||          ||||        | ||   |  || || |        | |  | ||| ^**     || | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | | |  | || |          |  ||| ||  |      || || |     |  |                                ^***        | ^***   | ||  |||||          ||||        | ||   |  ^***| |        | |  | ||| |       || | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | | |  | || |          |  ||| ||  |      || || |     |  |                                            |  |||   | ||  |||||          ||||        | ||   |   | || |        | |  | ||| |       || | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | | |  | || |          |  ||| ||  |      || || |     |  |                                            |  |||   | ||  |||||          ||||        | ^*****   | || |        | |  | ||| |       || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | | |  | || |          *********  |      || || |     |  |                                            *****|   | ||  |||||          ||||        |  |       | || |        | |  ***** |       || |          
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | | |  | || |          |  ||| ||  |      || || |     |  |                                            |  | |   | ||  *****          ||||        |  |       | || |        | |  | ||  |       || |          
search RasMol script viewer Motif-ligand binding stats  asxturn .. | ***  | || |          |  ||| ||  |      || || |     |  |                                            |  | |   ***|  ***||          ||||        |  |       ***| |        | |  | ||  |       || |          
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |    | || |          ********|  |      ****| |     |  |                                            **** |   |  |  ****|          ||||        |  |          | |        | |  ****  |       ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |    | || |             | | ||  |       | || |     |  |                                               | |   |  |  ||  |          ||||        |  |          | |        ***    |   |        | |          
search RasMol script viewer Motif-ligand binding stats  nest .. ***    | || |             | | ||  |       | || |     |  |                                               | |   |  |  ||  |          ****        |  |          ***               |   |        | |          
search RasMol script viewer Motif-ligand binding stats  niche .. ***    ******             | *******       ******     ****                                               ***   ****  |****                      ****                            |   |        ***          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                                                                                     *****                                                      *****                     

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |       | |   | |    || ||| |||||            |  |   | |    | |                         | ||        ^*** |    | || |||||           | |   |  ||  |    |  || |    | |    | |  |  || | |   | |  | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |       ^**   | |    || ||| ^**||            |  |   | |    | |                         ^**|          |  |    | || |||||           | |   |  ||  |    |  || |    | |    | |  |  || ^**   | |  | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |       | |   | |    || ||| |||||            |  |   | |    | |                         ^***          ^***    | || |||||           | |   |  ||  |    |  ^***    | |    | |  |  ||       | |  | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  |       | |   | |    || ||| |||||            |  |   | |    | |                                               | || |||||           | |   |  ||  |    |   | |    | |    | |  |  ||       | |  | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |       | |   | |    || ||| |||||            |  |   | |    | |                                               | || |||||           | |   |  ||  ^*****   | |    | |    | |  |  ||       | |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |       | |   | |    *****| |||||            |  |   | |    | |                                               | || *****           | |   *****           | |    | |    | |  *****       | |  |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|  |       | |   | |    || ||| |||||            |  |   | |    | |                                               | || *****           | |   |  |            | |    | |    | |  |  |        | |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |       | |   | |    || ||| |||||            |  |   | |    | |                                               | || ***||           | |   |  |            ***    | |    | |  |  |        | |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..****       | |   | |    ********||||            |  |   | |    | |                                               | || ****|           | |   ****                   | |    | |  ****        | ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |   | |     | | | |||||            |  |   | |    | |                                               | || ||  |           | |                          | |    ***              | |             
search RasMol script viewer Motif-ligand binding stats  nest ..           | |   | |     | | | |****            |  |   | |    | |                                               ***| ||  |           ***                          ***                     ***             
search RasMol script viewer Motif-ligand binding stats  niche ..           ***   ***     | | | |                ****   ***    ***                                                  *******                                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *******                                                                                                                                                                          

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |   | |    || ||| ||| |      |  |         | |             |  |           | | |||||       ^***||   | ||  |||||  |  |     | |   |  ||  |    |  || |           | |  || || ||||    || | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**   | |    || ||| ^** |      |  |         | |             |  |           | | ^**||       | ||||   | ||  |||||  |  |     | |   |  ||  |    |  || |           | |  || || ^**|    || | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |   | |    || ||| ||  |      |  |         | |             |  |           | | ^***|       | ^***   | ||  |||||  |  |     | |   |  ||  |    |  ^***           | |  || ||  | |    || | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | |   | |    || ||| ||  |      |  |         | |             |  |           | |  |  |       | ||||   | ||  |||||  |  |     | |   |  ||  |    |   | |           | |  || ||  | |    || | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |   | |    || ||| ||  |      |  |         | |             |  |           | |  |  |       | ||||   | ||  |||||  |  |     | |   |  ||  ^*****   | |           | |  || ||  | |    || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |   | |    *****| ||  |      |  |         | |             |  |           | |  |  |       | ||||   | ||  |||||  |  |     | |   *****           | |           | |  || ||  | |    || |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |   | |    || ||| ||  |      |  |         | |             |  |           | |  |  |       *****|   | ||  *****  |  |     | |   |  |            | |           | |  || ||  | |    || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |   | |    || ||| ||  |      |  |         | |             |  |           | |  |  |       ***| |   ***|  ***||  |  |     | |   |  |            ***           | |  || ||  | |    || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |   | |    ************      |  |         | |             ****           | |  |  |          | |   |  |  ****|  |  |     | |   ****                          | |  *****  | |    ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |   | |     | | | |          |  |         | |                            ***  |  |          | |   |  |   |  |  |  |     | |                                 ***         ***     | |          
search RasMol script viewer Motif-ligand binding stats  nest ..           | |   | |     | | | |          |  |         | |                              |  |  |          | |   |  |   |  |  |  |     ***                                             ***     | |          
search RasMol script viewer Motif-ligand binding stats  niche ..           ***   ***     | | | |          ****         ***                              *******          ***   ****   ****  ****                                                             ***          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *******                                                                                                                                                                          

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |   | || |          |  ||| |||          |  ||               | |||  || ||        | |   |||||       ^***||         |||||          ||||  || || | ||   |  || || |             |  || ||||    |  | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |   | |^**          |  ||| ^**          |  ||               | |||  || ||        | |   ^**||       | ||||         |||||          ||||  || || | ||   |  || || |             |  || ^**|    |  | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |   | |             |  ||| ||           |  ||               | |||  || ||        | |   ^***|       | ^***         |||||          ||||  || || | ||   |  ^***| |             |  ||  | |    |  | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |   | |             |  ||| ||           |  ||               | |||  || ||        | |    ||||       |  |||         |||||          ||||  || || | ||   |   | || |             |  ||  | |    |  | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |   | |             |  ||| ||           |  ||               | |||  || ||        | |    ||||       |  |||         |||||          ||||  || || | ^*****   | || |             |  ||  | |    |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |   | |             *****| ||           |  ||               *****  || ||        | |    ||||       |  |||         *****          ||||  || || |  |       | || |             *****  | |    |  |          
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |   | |             |  ||| ||           |  ||               *****  || ||        | |    ||||       |  |||         *****          ||||  || || |  |       | || |             |  |   | |    |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |   | |             |  ||| ||           |  ||               ***|   || ||        | |    ||||       |  |||         ***||          ||||  || || |  |       ***| |             |  |   | |    |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****   | |             ********|           ****|               ****   ****|        | |    ||||       |  |||         ****|          ||||  ***** |  |          | |             ****   | |    ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |                | | ||           |   |                       |  |        ***    ||||       |  |||          |  |          ||||        |  |          | |                    ***                  
search RasMol script viewer Motif-ligand binding stats  nest ..        | |                | | ||           |   |                       |  |               ****       |  |||          |  |          ****        |  |          ***                    ***                  
search RasMol script viewer Motif-ligand binding stats  niche ..        ***                | ****           |   |                       ****                          |  ***          ****                      ****                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****            *****                                                     *****                                                                                               

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |   | |    || ||| |||| |               | || |      |  ||  || ||             ||||||       ^***||       | |||||           | ||       | ||   |  || || | | |    | |  |  || | |   | || | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**   | |    || ||| ^**| |               | || |      |  ||  || ||             |^**||       | | ||       | |||||           | ||       | ||   |  || || | | |    | |  |  || ^**   | || | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |   | |    || ||| || | |               | || |      |  ||  || ||             |^***|       | ^***       | |||||           | ||       | ||   |  ^***| | | |    | |  |  ||       | || | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | |   | |    || ||| || | |               | || |      |  ||  || ||             | |  |       | | ||       | |||||           | ||       | ||   |   | || | | |    | |  |  ||       | || | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |   | |    || ||| || | |               | || |      |  ||  || ||             | |  |       | | ||       | |||||           | ||       | ^*****   | || | | |    | |  |  ||       | || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |   | |    *****| || | |               | || |      *****  || ||             | |  |       | | ||       | *****           | ||       |  |       | || | | |    | |  *****       | || |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |   | |    || ||| || | |               | || |      |  |   || ||             | |  |       *****|       | *****           | ||       |  |       | || | | |    | |  |  |        | || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |   | |    || ||| || | |               | || |      |  |   || ||             | |  |       ***  |       | ***||           | ||       |  |       ***| | | |    | |  |  |        | || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |   | |    ********| | |               | || |      ****   ****|             | |  |         |  |       | ****|           ****       |  |          | | | |    | |  ****        | ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |   | |     | | | || | |               | || |              |  |             | |  |         |  |       | ||  |           | |        |  |          | | | |    ***              | || |          
search RasMol script viewer Motif-ligand binding stats  nest ..           | |   | |     | | | || ***               | |***              |  |             | |  |         |  |       | ||  |           ***        |  |          *** ***                     ***| |          
search RasMol script viewer Motif-ligand binding stats  niche ..           ***   ***     | | ****                   ***                 ****             ******         ****       *******                      ****                                         ***          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |           *******                                                                                                                                                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                                                                                                                                                                            

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |    | |   | |    || ||| |||||      |  |                         || ||              |||||       ^***||    | |  ||| |  |  ||  | |  |  |  | | ||   |  || || |        | |  |  || | |     |  | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |    ^**   | |    || ||| ^**||      |  |                         || ||              ^**||       | ||||    | |  ||| |  |  ||  | |  |  |  | | ||   |  || || |        | |  |  || ^**     |  | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |    | |   | |    || ||| |||||      |  |                         || ||              ^***|       | ^***    | |  ||| |  |  ||  | |  |  |  | | ||   |  ^***| |        | |  |  ||         |  | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    | |    | |   | |    || ||| |||||      |  |                         || ||               |  |       |  |||    | |  ||| |  |  ||  | |  |  |  | | ||   |   | || |        | |  |  ||         |  | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |    | |   | |    || ||| |||||      |  |                         || ||               |  |       |  |||    | |  ||| |  |  ||  | |  |  |  | | ^*****   | || |        | |  |  ||         |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |    | |   | |    *****| |||||      |  |                         || ||               |  |       *****|    | |  ||| |  |  ||  | |  |  |  | |  |       | || |        | |  *****         |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |    | |   | |    || ||| |||||      |  |                         || ||               |  |       |  | |    | |  *** |  |  ||  | |  |  |  | |  |       ***| |        | |  |  |          |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |    | |   | |    ********||||      |  |                         ****|               |  |       **** |    | |   |  |  |  ||  | ****  **** |  |          | |        | |  ****          ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | |    | |   | |     | | | |***|      |  |                          |  |               |  |          | |    | |   |  |  |  ||  |            |  |          | |        ***                              
search RasMol script viewer Motif-ligand binding stats  nest ..    | |    | |   | |     | | | | | |      |  |                          |  |               |  |          | |    ***   |  |  |  ||  |            |  |          ***                                         
search RasMol script viewer Motif-ligand binding stats  niche ..    ***    ***   ***     | | | | ***      ****                          ****               ****          ***          ****  ********            ****                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *******                                                                                                                                                                          

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | || |   | |     | ||| ||| ||       | ||      |  |             |  ||              |||||       ^***||         || ||           | |   |  ||| ||   |  |  |           | |  |  || | |      | | | |    | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | |^**   | |     | ||| ^** ||       | ||      |  |             |  ||              ^**||       | ||||         || ||           | |   |  ||| ||   |  |  |           | |  |  || ^**      | | | |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | || |   | |     | ||| ||  ||       | ||      |  |             |  ||              ^***|       | ^***         || ||           | |   |  ||| ||   |  ^***           | |  |  ||          | | | |    | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | || |   | |     | ||| ||  ||       | ||      |  |             |  ||               |  |       | ||||         || ||           | |   |  ||| ||   |                 | |  |  ||          | | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | || |   | |     | ||| ||  ||       | ||      |  |             |  ||               |  |       | ||||         || ||           | |   |  ||| ^*****                 | |  |  ||          | | | |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | || |   | |     | |*********       | ||      |  |             *****               |  |       | ||||         *****           | |   *****|  |                     | |  *****          | | | |      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | || |   | |     | ||| ||  |        | ||      |  |             |  |                |  |       *****|         || ||           | |   |  | |  |                     | |  |  |           | | | |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | || |   | |     | ||| ||  |        | ||      |  |             |  |                |  |       ***| |         || ||           | |   |  | |  |                     | |  |  |           | | | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | || |   | |     | |********        ****      |  |             ****                |  |          | |         ****|           | |   **** |  |                     | |  ****           | | | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | || |   | |     | | | |            | ||      |  |                                 |  |          | |          |  |           | |        |  |                     ***                 | | ***      
search RasMol script viewer Motif-ligand binding stats  nest ..        | || |   | |     | | | |            ***|      |  |                                 |  |          | |          |  |           ***        |  |                                         | |          
search RasMol script viewer Motif-ligand binding stats  niche ..        ******   ***     | | | |            ****      ****                                 ****          ***          ****                      ****                                         ***          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *******                                                                                                                                                                          

Assembly 1  model: 11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |   | |    |  ||  ||| |          | |      | |      | |                       | ||        ^***||         |||||                 |  ||  | || |  || |    | |     ||| | ||| | |     |  | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**   | |    |  ||  ^** |          | |      | |      | |                       ^**|        | ||||         |||||                 |  ||  | || |  || |    | |     ||| | ||| ^**     |  | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |   | |    |  ||  ||  |          | |      | |      | |                       ^***        | ^***         |||||                 |  ||  | || |  ^***    | |     ||| | ||| |       |  | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | |   | |    |  ||  ||  |          | |      | |      | |                                   |  |||         |||||                 |  ||  | || |   | |    | |     ||| | ||| |       |  | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |   | |    |  ||  ||  |          | |      | |      | |                                   |  |||         |||||                 |  ||  ^*****   | |    | |     ||| | ||| |       |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |   | |    *****  ||  |          | |      | |      | |                                   *****|         *****                 *****    ||     | |    | |     ||| ***** |       |  |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |   | |    |  ||  ||  |          | |      | |      | |                                   |  | |         *****                 |  |     ||     | |    | |     ||| | ||  |       |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |   | |    |  ||  ||  |          | |      | |      ***                                   |  | |         ***||                 |  |     ||     ***    | |     ||| | ||  |       |  |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..           | |   | |    |  ||  ||  |          | |      | |                                            |  | |         || ||                 |  |     **            | |     ||| | ||  |       |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |   | |    ************          | |      | |                                            **** |         ****|                 ****                   | |     |*******  |       |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |   | |            |  |          | |      | |                                               | |          |  |                                        | |     ***   |   |       |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..           | |   | |            |  |          | |      | |                                               | |          |  |                                        ***           |   |       |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..           ***   ***            ****          ***      ***                                               ***          ****                                                      |   |       ****          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                *****                     

Assembly 1  model: 12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |||||  || |   | |    || ||| ||| |        | ||  |           | |  ||  || ||          | | | ||        ^*** |    | |  || ||  |  |    ||||          |    |  || || |        | ||  ||   | |     |  | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |||||  |^**   | |    || ||| ^** |        | ||  |           | |  ||  || ||          | | ^**|          |  |    | |  || ||  |  |    ||||          |    |  || || |        | ||  ||   ^**     |  | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |||||  || |   | |    || ||| ||  |        | ||  |           | |  ||  || ||          | | ^***          ^***    | |  || ||  |  |    ||||          |    |  ^***| |        | ||  ||           |  | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   |||||  || |   | |    || ||| ||  |        | ||  |           | |  ||  || ||          | |               |  |    | |  || ||  |  |    ||||          |    |   | || |        | ||  ||           |  | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |||||  || |   | |    || ||| ||  |        | ||  |           | |  ||  || ||          | |               |  |    | |  || ||  |  |    ||||          ^*****   | || |        | ||  ||           |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |||||  || |   | |    *****| ||  |        | ||  |           | *****  *****          | |               |  |    | |  || ||  |  |    ||||                   | || |        | |*****           |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |||||  || |   | |    || ||| ||  |        | ||  |           | |  |   || ||          | |               |  |    | |  || ||  |  |    ||||                   ***| |        | ||  |            |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |||||  || |   | |    ********|  |        | ||  |           | ****   ****|          | |               |  |    | |  ****|  |  |    ||||                      | |        | |****            ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |||||  || |   | |     |   |  |  |        | ||  |           | |       |  |          ***               |  |    | |  ||  |  |  |    ||||                      | |        ***                              
search RasMol script viewer Motif-ligand binding stats  nest ..   ****|  || |   | |     |   |  |  |        ***|  |           | |       |  |                            |  |    ***  ||  |  |  |    ****                      ***                                         
search RasMol script viewer Motif-ligand binding stats  niche ..       *******   ***     |   |  ****        *******           ***       ****                            ****         |****  ****                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *****                                                                                       *****                                                                                

Assembly 1  model: 13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |          |  ||  ||| |          |  |              | ||  ||  |               | ||       |^*** |         |||||         | | |   |  ||  |    |  || |    | |     | | |  || |||     |  | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**          |  ||  ^** |          |  |              | ||  ||  |               ^**|       ||||| |         |||||         | | |   |  ||  |    |  || |    | |     | | |  || ^**     |  | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |          |  ||  ||  |          |  |              | ||  ||  |               ^***       |||^***         |||||         | | |   |  ||  |    |  ^***    | |     | | |  ||  |      |  | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | |          |  ||  ||  |          |  |              | ||  ||  |                          ||||| |         |||||         | | |   |  ||  |    |   | |    | |     | | |  ||  |      |  | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |          |  ||  ||  |          |  |              | ||  ||  |                          ||||| |         |||||         | | |   |  ||  ^*****   | |    | |     | | |  ||  |      |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |          *****  ||  |          |  |              | |*****  |                          ||||| |         |||||         | | |   *****           | |    | |     | | *****  |      |  |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |          |  |   ||  |          |  |              | ||  ||  |                          ||||| |         *****         | | |   |  |            | |    | |     | | |  ||  |      |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |          |  |   ||  |          |  |              ***|  ||  |                          ||||| |         ***||         | | |   |  |            ***    | |     | | |  ||  |      |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |          ****   |****          |  |                 ********                          |**** |         ****|         | | |   ****                   | |     | | ****|  |      ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |             |   ||  |          |  |                                                   ***|  |          |  |         *** |                          | |     | |     |  |                    
search RasMol script viewer Motif-ligand binding stats  nest ..           | |             |   ||  |          |  |                                                      |  |          |  |           ***                          ***     ***     |  |                    
search RasMol script viewer Motif-ligand binding stats  niche ..           ***             |   |****          ****                                                      ****          ****                                                        ****                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                                                                                                                                                                          

Assembly 1  model: 14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |      |  | | ||| |||| |                         | | |||  |  |               ||||        ^***||   | |   || ||          ||||          |    |  || |    | |    | |  |  || | |     || | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**      |  | | ||| ^**| |                         | | |||  |  |               ^**|        | ||||   | |   || ||          ||||          |    |  || |    | |    | |  |  || ^**     || | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |      |  | | ||| || | |                         | | |||  |  |               ^***        | ^***   | |   || ||          ||||          |    |  ^***    | |    | |  |  ||         || | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | |      |  | | ||| || | |                         | | |||  |  |                | |        |  |||   | |   || ||          ||||          |    |   | |    | |    | |  |  ||         || | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |      |  | | ||| || | |                         | | |||  |  |                | |        |  |||   | |   || ||          ||||          ^*****   | |    | |    | |  |  ||         || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |      |  | | |***** | |                         | | |||  |  |                | |        *****|   | |   || ||          ||||                   | |    | |    | |  *****         || |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |      |  | | ||| || | |                         | *****  |  |                | |        |  | |   | |   || ||          ||||                   | |    | |    | |  |  |          || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |      |  | | ||| || | |                         | ***|   |  |                | |        |  | |   ***   || ||          ||||                   ***    | |    | |  |  |          || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |      |  | | |****| | |                         | ****   ****                | |        **** |         ****|          ||||                          | |    | |  ****          ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |      |  | | | | || | |                         | |                          ***           | |         ||  |          ||||                          | |    ***                 | |          
search RasMol script viewer Motif-ligand binding stats  nest ..           | |      |  | | | | || ***                         | |                          ***           | |         ||  |          ****                          ***                        | |          
search RasMol script viewer Motif-ligand binding stats  niche ..           ***      **** | | ****                             ***                                        ***         |****                                                                   ***          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *******                                                                                     *****                                                                                

Assembly 1  model: 15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | |   | |   | |     | ||| ||| |                                   || ||            | |||||       ^*** |   |  |  |||||           | |   |  ||| ||   |  |  |                | ||  | |     |  | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | |   ^**   | |     | ||| ^** |                                   || ||            | ^**||         || |   |  |  |||||           | |   |  ||| ||   |  |  |                | ||  ^**     |  | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |   | |   | |     | ||| ||  |                                   || ||            | ^***|         ^***   |  |  |||||           | |   |  ||| ||   |  ^***                | ||  |       |  | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     | |   | |   | |     | ||| ||  |                                   || ||            | ||| |          | |   |  |  |||||           | |   |  ||| ||   |                      | ||  |       |  | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |   | |   | |     | ||| ||  |                                   || ||            | ||| |          | |   |  |  |||||           | |   |  ||| ^*****                      | ||  |       |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |   | |   | |     | ||| ||  |                                   *****            | ||| |          | |   |  |  |||||           | |   *****|  |                          | ||  |       |  |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     | |   | |   | |     | ||| ||  |                                   || ||            | ||| |          | |   |  |  *****           | |   |  | |  |                          | ||  |       |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |   | |   | |     | ||| ||  |                                   || ||            | ||| |          | |   |  |  ***||           | |   |  | |  |                          | ||  |       |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |   | |   | |     | |****|  |                                   ****|            *******          | |   |  |  ****|           | |   **** |  |                          ****  |       ****          
search RasMol script viewer Motif-ligand binding stats  nest ..     | |   | |   | |     | | | ||  |                                    |  |              *** |          | |   |  |  ||  |           ***        |  |                            |   |                     
search RasMol script viewer Motif-ligand binding stats  niche ..     ***   ***   ***     | | *******                                    ****               ****          ***   ****  |****                      ****                            |   |                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *******                                                                                     *****                                                      *****                     

Assembly 1  model: 16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |   | ||  |   ||  | |        |  | |  |    | |      | |    || ||         | |  | ||        ^*** |    | |  |||||  |  | |   | |          |    |  |  |    | |    | |  | ||| ||||    |  | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**   | ||  |   ||  ^**        |  | |  |    | |      | |    || ||         | |  ^**|          |  |    | |  |||||  |  | |   | |          |    |  |  |    | |    | |  | ||| ^**|    |  | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |   | ||  |   ||  |          |  | |  |    | |      | |    || ||         | |  ^***          ^***    | |  |||||  |  | |   | |          |    |  ^***    | |    | |  | ||| || |    |  | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | |   | ||  |   ||  |          |  | |  |    | |      | |    || ||         | |                |  |    | |  |||||  |  | |   | |          |    |          | |    | |  | ||| || |    |  | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |   | ||  |   ||  |          |  | |  |    | |      | |    || ||         | |                |  |    | |  |||||  |  | |   | |          ^*****          | |    | |  | ||| || |    |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |   | ||  |   ||  |          |  | |  |    | |      | |    || ||         | |                |  |    | |  *****  |  | |   | |                          | |    | |  ***** || |    |  |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |   | ||  |   ||  |          |  | |  |    | |      | |    || ||         | |                |  |    | |  *****  |  | |   | |                          | |    | |  | ||  || |    |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |   | ||  |   ||  |          |  | |  |    | |      ***    || ||         | |                |  |    | |  ***||  |  | |   | |                          | |    | |  | ||  || |    |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |   | ||  |   |****          **** |  |    | |             ****|         | |                |  |    | |  ****|  |  | |   | |                          | |    | |  ****  || |    ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |   | ||  |   |   |          |  | |  |    | |              |  |         | |                |  |    | |   |  |  |  ***   | |                          | |    ***    |   || |    |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..           | |   | ||  |   |   |          |  | |  |    | |              |  |         | |                |  |    ***   |  |  |  |     ***                          ***           |   |***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..           ***   *******   |   |          **** ****    ***              ****         ***                ****          ****  ****                                                |   |       ****          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                                                                                                                                                *****                     

Assembly 1  model: 17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |   | |    |  ||  ||| |                            | |    |  ||            | ||||        ^***||  | | |  ||| |          ||||   |  ||  |    |  || || |             |  || ||||    || | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**   | |    |  ||  ^** |                            | |    |  ||            | ^**|        | ||||  | | |  ||| |          ||||   |  ||  |    |  || || |             |  || ^**|    || | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |   | |    |  ||  ||  |                            | |    |  ||            | ^***        | ^***  | | |  ||| |          ||||   |  ||  |    |  ^***| |             |  ||  | |    || | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | |   | |    |  ||  ||  |                            | |    |  ||            |  |          |  |||  | | |  ||| |          ||||   |  ||  |    |   | || |             |  ||  | |    || | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |   | |    |  ||  ||  |                            | |    |  ||            |  |          |  |||  | | |  ||| |          ||||   |  ||  ^*****   | || |             |  ||  | |    || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |   | |    *****  ||  |                            | |    *****            |  |          |  |||  | | |  ||| |          ||||   *****           | || |             *****  | |    || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |   | |    |  |   ||  |                            ***    |  |             |  |          |  |||  | | |  *** |          ||||   |  |            ***| |             |  |   | |    || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |   | |    ****   ||  |                                   ****             ****          ****||  | | |  ||  |          ||||   ****               | |             ****   | |    ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |   | |       |   ||  |                                                    |  |          |  |||  | ***  ||  |          ||||                      | |                    ***     | |          
search RasMol script viewer Motif-ligand binding stats  nest ..           | |   | |       |   ||  |                                                    |  |          |  |||  ***    ||  |          ****                      ***                    ***     | |          
search RasMol script viewer Motif-ligand binding stats  niche ..           ***   ***       |   |****                                                    ****          |  ***         |****                                                                   ***          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                                                                      *****          *****                                                                                

Assembly 1  model: 18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |     | |   | ||  | |  || ||| |      |  ||  |     | |     ||||||  |  |             | ||||        ^*** |   |  |  |||||                 |  ||| ||   |  || || |                 | |||     || | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |     ^**   | ||  | |  || ^** |      |  ||  |     | |     ||||||  |  |             | ^**|          |  |   |  |  |||||                 |  ||| ||   |  || || |                 | ^**     || | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |     | |   | ||  | |  || ||  |      |  ||  |     | |     ||||||  |  |             | ^***          ^***   |  |  |||||                 |  ||| ||   |  ^***| |                 |  |      || | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | |     | |   | ||  | |  || ||  |      |  ||  |     | |     ||||||  |  |             |  |            |  |   |  |  |||||                 |  ||| ||   |   | || |                 |  |      || | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |     | |   | ||  | |  || ||  |      |  ||  |     | |     ||||||  |  |             |  |            |  |   |  |  |||||                 |  ||| ^*****   | || |                 |  |      || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |     | |   | ||  | |  || ||  |      |  ||  |     | |     ||||||  |  |             |  |            |  |   |  |  |||||                 *****|  |       | || |                 |  |      || |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | |     | |   | ||  | |  || ||  |      |  ||  |     | |     |*****  |  |             |  |            |  |   |  |  *****                 |  | |  |       | || |                 |  |      || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |     | |   | ||  | |  || ||  |      |  ||  |     | |     |***|   |  |             |  |            |  |   |  |  ***||                 |  | |  |       ***| |                 |  |      || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |     | |   | ||  | |  ********      |  ||  |     | |     |****   ****             ****            |  |   |  |  ****|                 **** |  |          | |                 ****      ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |     | |   | ||  | |   |            |  ||  |     | |     ***                      |  |            |  |   |  |  ||  |                      |  |          | |                            | |          
search RasMol script viewer Motif-ligand binding stats  nest ..   ***     | |   | ||  | |   |            |  ||  |     ***                              |  |            |  |   |  |  ||  |                      |  |          ***                            | |          
search RasMol script viewer Motif-ligand binding stats  niche ..           ***   ******* |   |            ********                                      ****            ****   ****  |****                      ****                                         ***          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *****                                                                                       *****                                                                                

Assembly 1  model: 19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |   | ||  ||| ||| ||| |           |  |    | |      | |    |  |               | ||        ^***||         |||||           | |   |  | | ||   |  || || | | |    | |  |  || ||||    || | ||     | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           ^**   | ||  ||| ||| ^** |           |  |    | |      | |    |  |               ^**|        | ||||         |||||           | |   |  | | ||   |  || || | | |    | |  |  || ^**|    || | ||     | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |   | ||  ||| ||| ||  |           |  |    | |      | |    |  |               ^***        | ^***         |||||           | |   |  | | ||   |  ^***| | | |    | |  |  ||  | |    || | ||     | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | |   | ||  ||| ||| ||  |           |  |    | |      | |    |  |                           |  |||         |||||           | |   |  | | ||   |   | || | | |    | |  |  ||  | |    || | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |   | ||  ||| ||| ||  |           |  |    | |      | |    |  |                           |  |||         |||||           | |   |  | | ^*****   | || | | |    | |  |  ||  | |    || |  |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |   | ||  |*****| ||  |           |  |    | |      | |    |  |                           |  |||         |||||           | |   |  | |  |       | || | | |    | |  *****  | |    || |  |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |   | ||  ||| ||| ||  |           |  |    | |      | |    |  |                           |  |||         *****           | |   |  | |  |       | || | | |    | |  |  |   | |    || |  |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |   | ||  ||| ||| ||  |           |  |    | |      ***    |  |                           |  |||         ***||           | |   |  | |  |       ***| | | |    | |  |  |   | |    || |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |   | ||  |********|  |           |  |    | |             ****                           |  |||         ****|           | |   **** |  |          | | | |    | |  ****   | |    ****  |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |   | ||  | | | | ||  |           |  |    | |                                            |  |||          |  |           | |        |  |          | | | |    ***         | |     | |  |       
search RasMol script viewer Motif-ligand binding stats  nest ..           | |   | ||  | | | | ||  |           |  |    | |                                            |  |||          |  |           ***        |  |          *** ***                ***     | |  |       
search RasMol script viewer Motif-ligand binding stats  niche ..           | |   ******* | | *******           ****    ***                                            |  ***          ****                      ****                                         ******       
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |           *******                                                                      *****                                                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                                                                                                                                                                            

Assembly 1  model: 20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTE
member of: GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR12566/searchPTHR12566_SF2PFAM:searchPF00076PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchQ17RY0
sec str:  .............eeeeee.......hhhhhhhhh.....eeee................eeeee...hhhhhhhhh.ee....eee...........eeeeee.....eee...........eeeee.......hhhhhhhhhhhh....eeeeeee....eeeeeeeee...hhhhhhhhh....eeee..eee..eeee..
sequence :  ..SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
seq num:  ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | || |      |  ||| ||| | |              |  |                   |  |          | | || ||        ^*** |   |  |  || ||     | |   | |  || |||  |    |  |  |    | |           |   | |     || | |      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | |^**      |  ||| ||| ^**              |  |                   |  |          | | |^**|        | || |   |  |  || ||     | |   | |  || |||  |    |  |  |    | |           |   ^**     || | |      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |         |  ||| ||| |                |  |                   |  |          | | |^***        | ^***   |  |  || ||     | |   | |  || |||  |    |  ^***    | |           |   |       || | |      | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | |         |  ||| ||| |                |  |                   |  |          | | |  |         |  | |   |  |  || ||     | |   | |  || |||  |    |          | |           |   |       || | *******^ 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |         |  ||| ||| |                |  |                   |  |          | | |  |         |  | |   |  |  || ||     | |   | |  || |||  ^*****          | |           |   |       || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |         |  |*****| |                |  |                   |  |          | | |  |         |  | |   |  |  || ||     | |   | |  |*****                  | |           |   |       || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |         |  |********                |  |                   ****          | | |  |         **** |   |  |  ****|     | |   | |  *****                   | |           |   |       ****          
search RasMol script viewer Motif-ligand binding stats  nest ..        | |         |  | | | | |                |  |                                 | | |  |            | |   |  |   |  |     | |   ***                          ***           |   |        | |          
search RasMol script viewer Motif-ligand binding stats  niche ..        ***         **** | | | |                ****                                 *** ****            ***   ****   ****     ***                                              |   |        ***          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *******                                                                                                                                                *****                     

   New search    2mkj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML