triangle PDBeMotif: 2mf9  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   5.2.1.8
Classification apoptosis, isomerase    | release date: Tue, Oct 8, 2013
Title solution structure of the n-terminal domain of human fkbp38 (fkbp38ntd)
Authors B.SIMON, C.KANG, H.S.YOON, H.YE, M.SATTLER
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRV
QEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |              | | |      | |  ||||||||| ||||     | |   | || |   | ||^***         | ||||| |  |  |  ||  |      || ||                     | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |              | | |      | |  ||||||||**^*||     | |   | || |   | |||||          | ||||| |  |  |  ||  |      || ||                     | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |              | | |      | |  ||||||||    ||     ^**   | || |   | |||||          | ||||| |  |  |  ||  |      || ||                     ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |              | | |      | |  ||||||||    ||           | || |   ^***|||          ^***||| |  |  |  ||  |      || ||                        ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****              | | |      | |  ||||||||    ||           ^*****     | |||            ||||| |  |  |  ||  |      || ||                                    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | | |      | |  ||||||||    ||             ||       | |||            ||||| |  |  |  ||  |      *****                                    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | | |      | |  ||||||||    **             ||       | |||            ||||| |  |  |  ||  |      || ||                                    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                     | | |      | |  ||||||||                   ||       *****            ||||| |  |  |  ||  |      || ||                                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | | |      | |  ****||||                   ||       ****|            ||||| ****  ********      *****                                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     | ***      ***   |||||||                   ||         | |            |||||       |  ||  |                                               
search RasMol script viewer Motif-ligand binding stats  nest ..                     | |              |******                   ||         ***            *****       |  ||  |                                               
search RasMol script viewer Motif-ligand binding stats  niche ..                     ***              ||                        ||                                    ********                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |   || |   | |                |  |  ||||||||| ||||     | | | |||| |   | ||^***         | |||||  |  |||  ||  |      | |||           |  |      | ||  |  ||||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |   || |   | |                |  |  ||||||||**^*||     | | | |||| |   | |||||          | |||||  |  |||  ||  |      | |||           |  |      | ||  |  ||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |   || |   | |                |  |  ||||||||    ||     ^** | |||| |   | |||||          | |||||  |  |||  ||  |      | |||           |  |      ^**|  |  ||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |   || |   | |                |  |  ||||||||    ||         | |||| |   ^***|||          ^***|||  |  |||  ||  |      | |||           |  |         ^***  ||||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^***** |   | |                |  |  ||||||||    ||         | ^*****     | |||          | |||||  |  |||  ||  |      | |||           |  |               ||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |   | |                |  |  ||||||||    ||         |  |||       | |||          | |||||  *****|  ||  |      *****           |  |               ||||  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     |  |   | |                |  |  ||||||||    ||         |  |||       | |||          | |||||  |  | |  ||  |      *****           |  |               ||||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |   | |                |  |  ||||||||    ||         |  |||       | |||          | |||||  |  | |  ||  |      ***|            |  |               ||||  
search RasMol script viewer Motif-ligand binding stats  betabulge ..     |  |   | |                |  |  ||||||||    **         |  |||       | |||          | |||||  |  | |  ||  |      |  |            |  |               ||||  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     |  |   | |                |  |  ||||||||               |  |||       *****          | |||||  |  | |  ||  |      |  |            |  |               ||||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |   | |                ****  ****||||               |  |||       ****|          ****|||  **** ********      ****            ****               ||||  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |   | |                       |||||||               |  |||         | |            |||||       |  ||  |                      |  |               |***  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |   | |                       |******               |  |||         ***            *****       |  ||  |                      |  |               ***   
search RasMol script viewer Motif-ligand binding stats  niche ..     ****   ***                       ||                    ****||                                    ********                      ****               ***   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  | ||                             ||||||||| ||||  |  | | | |||| |   | ||^***         | ||||||| ||  |  ||  |      |||||           |  |      | ||  | ||||   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  | ||                             ||||||||**^*||  |  | | | |||| |   | |||||          | ||||||| ||  |  ||  |      |||||           |  |      | ||  | ||||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  | ||                             ||||||||    ||  |  ^** | |||| |   | |||||          | ||||||| ||  |  ||  |      |||||           |  |      ^**|  | ||||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  | ||                             ||||||||    ||  |  |   | |||| |   ^***|||          ^***||||| ||  |  ||  |      |||||           |  |         ^*** ||||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****|                             ||||||||    ||  |  |   | ^*****     | |||          | ||||||| ||  |  ||  |      |||||           |  |              ||||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    |  |                             ||||||||    ||  |  |   |  |||       | |||          | |||||*****  |  ||  |      *****           |  |              ||||   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    |  |                             ||||||||    ||  |  |   |  |||       | |||          | ||||||| ||  |  ||  |      *****           |  |              ||||   
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |  |                             ||||||||    ||  |  |   |  |||       | |||          | ||||||| ||  |  ||  |      ***||           |  |              ||||   
search RasMol script viewer Motif-ligand binding stats  betabulge ..    |  |                             ||||||||    **  |  |   |  |||       | |||          | ||||||| ||  |  ||  |      || ||           |  |              ||||   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    |  |                             ||||||||        |  |   |  |||       *****          | ||||||| ||  |  ||  |      || ||           |  |              ||||   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  |                             ****||||        |  |   |  |||       ****|          ****|||*****  ********      *****           |  |              ||||   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    |  |                              |||||||        |  |   |  |||         | |            |||||       |  ||  |                      |  |              |***   
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |                              |******        |  |   |  |||         ***            *****       |  ||  |                      |  |              ***    
search RasMol script viewer Motif-ligand binding stats  niche ..    ****                              ||             ****   ****||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|||   || |   |||||                    |||||||| ||||  | || | | |||| |   | ||^***         | ||||| |  |  |  ||  |      |||||           |  |      | ||  |   | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|||   || |   |||||                    |||||||**^*||  | || | | |||| |   | |||||          | ||||| |  |  |  ||  |      |||||           |  |      | ||  |   | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|||   || |   |||||                    |||||||    ||  | |^** | |||| |   | |||||          | ||||| |  |  |  ||  |      |||||           |  |      ^**|  |   | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|||   || |   |||||                    |||||||    ||  | |    | |||| |   ^***|||          ^***||| |  |  |  ||  |      |||||           |  |         ^***   | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|^*****| |   |||||                    |||||||    ||  | |    | ^*****     | |||          | ||||| |  |  |  ||  |      |||||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |    | |   |||||                    |||||||    ||  | |    |  |||       | |||          | ||||| |  |  |  ||  |      *****           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..| |    | |   |||||                    |||||||    ||  | |    |  |||       | |||          | ||||| |  |  |  ||  |      *****           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..| |    | |   |||||                    |||||||    ||  | |    |  |||       | |||          | ||||| |  |  |  ||  |      ***||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..| |    | |   |||||                    |||||||    **  | |    |  |||       | |||          | ||||| |  |  |  ||  |      || ||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..| |    | |   |||||                    |||||||        | |    |  |||       *****          | ||||| |  |  |  ||  |      || ||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |    | |   |||||                    |||||||        | |    |  |||       ****|          ****||| ****  ********      *****           ****                | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***    ***   |||||                    |||||||        ***    |  |||         | |            |||||       |  ||  |                      |  |                ***  
search RasMol script viewer Motif-ligand binding stats  nest ..             *****                    |******               |  |||         ***            *****       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ||                    ****||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |             |  |             ||||||| | ||||     | | | |||| |   | ||^***         | |||||       |  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |             |  |             ||||||| **^*||     | | | |||| |   | |||||          | |||||       |  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |             |  |             |||||||     ||     ^** | |||| |   | |||||          | |||||       |  ||  |      |||||           |  |      ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |             |  |             |||||||     ||         | |||| |   ^***|||          ^***|||       |  ||  |      |||||           |  |         ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****             |  |             |||||||     ||         | ^*****     | |||          | |||||       |  ||  |      |||||           |  |                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                    |  |             |||||||     ||         |  |||       | |||          | |||||       |  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                    |  |             |||||||     ||         |  |||       | |||          | |||||       |  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..                    |  |             |||||||     ||         |  |||       | |||          | |||||       |  ||  |      ***||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..                    |  |             |||||||     **         |  |||       | |||          | |||||       |  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    |  |             ****|||                ****||       ****|          ****|||       ********      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..                    |  |              |*****                |  |||         ***            *****       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****              ||                    ****||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    | | |  |||||   | | | |         ||||||||| ||||     | |   | || |   | ||^***         | |||||| ||| ||  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    | | |  |||||   | | | |         ||||||||**^*||     | |   | || |   | |||||          | |||||| ||| ||  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    | | |  |||||   | | | |         ||||||||    ||     ^**   | || |   | |||||          | |||||| ||| ||  ||  |      |||||           |  |      ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    | | |  |||||   | | | |         ||||||||    ||           | || |   ^***|||          ^***|||| ||| ||  ||  |      |||||           |  |         ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^***** | |  |||||   | | | |         ||||||||    ||           ^*****     | |||          | |||||| ||| ||  ||  |      |||||           |  |                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |  |||||   | | | |         ||||||||    ||             ||       | |||          | |||||***** ||  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | |  |||||   | | | |         ||||||||    ||             ||       | |||          | |||||| ||  ||  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |  |||||   | | | |         ||||||||    ||             ||       | |||          | |||||| ||  ||  ||  |      ***||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..        | |  |||||   | | | |         ||||||||    **             ||       | |||          | |||||| ||  ||  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        | |  |||||   | | | |         ||||||||                   ||       *****          | |||||| ||  ||  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |  |||||   | | | |         ****||||                   ||       ****|          ****|||****  |********      *****           ****                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ***  |||||   | | ***          |||||||                   ||         | |            |||||  |   ||  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..             *****   | |              |******                   ||         ***            *****  |   ||  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                     ***              ||                        ||                               |   |********                      ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                      ||                        ||                               *****                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |||||| |  | |            | ||| ||||||||| ||||  | || | | |||| |   | ||^***         | |||||| ||| ||  ||  |      | |||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |||||| |  | |            | ||| ||||||||**^*||  | || | | |||| |   | |||||          | |||||| ||| ||  ||  |      | |||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |||||| |  | |            | ||| ||||||||    ||  | |^** | |||| |   | |||||          | |||||| ||| ||  ||  |      | |||           |  |      ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |||||| |  | |            | ||| ||||||||    ||  | |    | |||| |   ^***|||          ^***|||| ||| ||  ||  |      | |||           |  |         ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****||||| |  | |            | ||| ||||||||    ||  | |    | ^*****     | |||          | |||||| ||| ||  ||  |      | |||           |  |                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ||||| |  | |            | ||| ||||||||    ||  | |    |  |||       | |||          | |||||***** ||  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       ||||| |  | |            | ||| ||||||||    ||  | |    |  |||       | |||          | |||||| ||  ||  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ||||| |  | |            | ||| ||||||||    ||  | |    |  |||       | |||          | |||||| ||  ||  ||  |      ***|            |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..       ||||| |  | |            | ||| ||||||||    **  | |    |  |||       | |||          | |||||| ||  ||  ||  |      |  |            |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       ||||| |  | |            | ||| ||||||||        | |    |  |||       *****          | |||||| ||  ||  ||  |      |  |            |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ||||| |  | |            | ||| ****||||        | |    ****||       ****|          ****|||****  |********      ****            |  |                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ||||***  | |            | ***  |||||||        ***    |  |||         | |            |||||  |   ||  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..       ****     ***            |  |   |******               |  |||         ***            *****  |   ||  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                               ****   ||                    ****||                               |   |********                      ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                      ||                        ||                               *****                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |   |  |                        |||||||| ||||  | || | | |||| |   | ||^***         | |||||       |  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |   |  |                        |||||||**^*||  | || | | |||| |   | |||||          | |||||       |  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |   |  |                        |||||||    ||  | |^** | |||| |   | |||||          | |||||       |  ||  |      |||||           |  |      ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |   |  |                        |||||||    ||  | |    | |||| |   ^***|||          ^***|||       |  ||  |      |||||           |  |         ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****   |  |                        |||||||    ||  | |    | ^*****     | |||          | |||||       |  ||  |      |||||           |  |                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |                        |||||||    ||  | |    |  |||       | |||          | |||||       |  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  |                        |||||||    ||  | |    |  |||       | |||          | |||||       |  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |                        |||||||    ||  | |    |  |||       | |||          | |||||       |  ||  |      ***||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |                        |||||||    **  | |    |  |||       | |||          | |||||       |  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          |  |                        |||||||        | |    |  |||       *****          | |||||       |  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |                        |||||||        | |    ****||       ****|          ****|||       ********      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  |                        |||||||        ***    |  |||         | |            |||||       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |                        |******               |  |||         ***            *****       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                        ||                    ****||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |      ||||                    ||||||||| ||||     | | | |||| |   | ||^***         | ||||| || | ||  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |      ||||                    ||||||||**^*||     | | | |||| |   | |||||          | ||||| || | ||  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |      ||||                    ||||||||    ||     ^** | |||| |   | |||||          | ||||| || | ||  ||  |      |||||           |  |      ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |      ||||                    ||||||||    ||         | |||| |   ^***|||          ^***||| || | ||  ||  |      |||||           |  |         ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****      ||||                    ||||||||    ||         | ^*****     | |||          | ||||| || | ||  ||  |      |||||           |  |                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             ||||                    ||||||||    ||         |  |||       | |||          | ||||| || | ||  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..             ||||                    ||||||||    ||         |  |||       | |||          | ||||| || | ||  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..             ||||                    ||||||||    ||         |  |||       | |||          | ||||| || | ||  ||  |      ***||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..             ||||                    ||||||||    **         |  |||       | |||          | ||||| || | ||  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..             ||||                    ||||||||               |  |||       *****          | ||||| || | ||  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ||||                    ****||||               |  |||       ****|          ****||| **** |********      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ****                     |||||||               |  |||         | |            |||||  |   ||  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..                                      |******               |  |||         ***            *****  |   ||  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ||                    ****||                               |   |********                      ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                      ||                        ||                               *****                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |       |||||||          | | |  |||||||| ||||  | || |   | || |   | ||^***         | |||||||||| ||  ||  |      | |||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |       |||||||          | | |  |||||||**^*||  | || |   | || |   | |||||          | |||||||||| ||  ||  |      | |||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |       |||||||          | | |  |||||||    ||  | |^**   | || |   | |||||          | |||||||||| ||  ||  |      | |||           |  |      ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |       |||||||          | | |  |||||||    ||  | |      | || |   ^***|||          ^***|||||||| ||  ||  |      | |||           |  |         ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****       |||||||          | | |  |||||||    ||  | |      ^*****     | |||          | |||||||||| ||  ||  |      | |||           |  |                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              |||||||          | | |  |||||||    ||  | |        ||       | |||          | |||||***** ||  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..              |||||||          | | |  |||||||    ||  | |        ||       | |||          | |||||||||| ||  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..              |||||||          | | |  |||||||    ||  | |        ||       | |||          | |||||||||| ||  ||  |      ***|            |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..              |||||||          | | |  |||||||    **  | |        ||       | |||          | |||||||||| ||  ||  |      |  |            |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..              |||||||          | | |  |||||||        | |        ||       *****          | |||||||||| ||  ||  |      |  |            |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |||||||          | | |  |||||||        | |        ||       ****|          ****|||***** |********      ****            ****                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              ||||***          | ***  |||||||        ***        ||         | |            |||||  |   ||  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..              **** |           | |    |******                   ||         ***            *****  |   ||  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..               *****           ***    ||                        ||                               |   |********                      ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                      ||                        ||                               *****                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |    | |      |  |       | |   ||||||||| ||||     | |   | || |   | ||^***         | ||||||| ||  |  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |    | |      |  |       | |   ||||||||**^*||     | |   | || |   | |||||          | ||||||| ||  |  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |    | |      |  |       | |   ||||||||    ||     ^**   | || |   | |||||          | ||||||| ||  |  ||  |      |||||           |  |      ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |    | |      |  |       | |   ||||||||    ||           | || |   ^***|||          ^***||||| ||  |  ||  |      |||||           |  |         ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****    | |      |  |       | |   ||||||||    ||           ^*****     | |||            ||||||| ||  |  ||  |      |||||           |  |                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |      |  |       | |   ||||||||    ||             ||       | |||            |||||*****  |  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |      |  |       | |   ||||||||    ||             ||       | |||            ||||||| ||  |  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |      |  |       | |   ||||||||    ||             ||       | |||            ||||||| ||  |  ||  |      ***||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..           | |      |  |       | |   ||||||||    **             ||       | |||            ||||||| ||  |  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |      |  |       | |   ****||||                   ||       ****|            |||||*****  ********      *****           ****                     
search RasMol script viewer Motif-ligand binding stats  nest ..           | |      |  |       | |    |******                   ||         ***            *****       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..           ***      ****       ***    ||                        ||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |                              ||||||||| ||||     | |   | || |   | ||^***         | ||||| |  |  |  ||  |      | |||           |  |      | ||  |     | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |                              ||||||||**^*||     | |   | || |   | |||||          | ||||| |  |  |  ||  |      | |||           |  |      | ||  |     | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |                              ||||||||    ||     ^**   | || |   | |||||          | ||||| |  |  |  ||  |      | |||           |  |      ^**|  |     | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |                              ||||||||    ||           | || |   ^***|||          ^***||| |  |  |  ||  |      | |||           |  |         ^***     | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****                              ||||||||    ||           ^*****     | |||          | ||||| |  |  |  ||  |      | |||           |  |                  | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                     ||||||||    ||             ||       | |||          | ||||| |  |  |  ||  |      *****           |  |                  | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                                     ||||||||    ||             ||       | |||          | ||||| |  |  |  ||  |      *****           |  |                  | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..                                     ||||||||    ||             ||       | |||          | ||||| |  |  |  ||  |      ***|            |  |                  | |
search RasMol script viewer Motif-ligand binding stats  betabulge ..                                     ||||||||    **             ||       | |||          | ||||| |  |  |  ||  |      |  |            |  |                  | |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                                     ||||||||                   ||       *****          | ||||| |  |  |  ||  |      |  |            |  |                  | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                     ****||||                   ||       ****|          ****||| ****  ********      ****            ****                  | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                      |||||||                   ||         | |            |||||       |  ||  |                      |  |                  ***
search RasMol script viewer Motif-ligand binding stats  nest ..                                      |******                   ||         ***            *****       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ||                        ||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    || |     ||||      | |         ||||||||| ||||     | |   | || |   | ||^***         | |||||       |  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    || |     ||||      | |         ||||||||**^*||     | |   | || |   | |||||          | |||||       |  ||  |      |||||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    || |     ||||      | |         ||||||||    ||     ^**   | || |   | |||||          | |||||       |  ||  |      |||||           |  |      ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    || |     ||||      | |         ||||||||    ||           | || |   ^***|||          ^***|||       |  ||  |      |||||           |  |         ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****| |     ||||      | |         ||||||||    ||           ^*****     | |||          | |||||       |  ||  |      |||||           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |     ||||      | |         ||||||||    ||             ||       | |||          | |||||       |  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |     ||||      | |         ||||||||    ||             ||       | |||          | |||||       |  ||  |      ***||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..       | |     ||||      | |         ||||||||    **             ||       | |||          | |||||       |  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       | |     ||||      | |         ||||||||                   ||       *****          | |||||       |  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |     ||||      | |         ****||||                   ||       ****|          ****|||       ********      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***     ||||      ***          |||||||                   ||         | |            |||||       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..               ****                   |******                   ||         ***            *****       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ||                        ||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |       | |      | |            |||||||| ||||     | | | |||| |   | ||^***         | |||||  |  |||  ||  |      |||||           |  |      | ||  | |      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |       | |      | |            |||||||**^*||     | | | |||| |   | |||||          | |||||  |  |||  ||  |      |||||           |  |      | ||  | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |       | |      | |            |||||||    ||     ^** | |||| |   | |||||          | |||||  |  |||  ||  |      |||||           |  |      ^**|  | |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |       | |      | |            |||||||    ||         | |||| |   ^***|||          ^***|||  |  |||  ||  |      |||||           |  |         ^*** |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****       | |      | |            |||||||    ||         | ^*****     | |||          | |||||  |  |||  ||  |      |||||           |  |            | |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              | |      | |            |||||||    ||         |  |||       | |||          | |||||  *****|  ||  |      *****           |  |            | |      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..              | |      | |            |||||||    ||         |  |||       | |||          | |||||  |  | |  ||  |      *****           |  |            | |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..              | |      | |            |||||||    ||         |  |||       | ***          | |||||  |  | |  ||  |      ***||           |  |            ***      
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |      | |            |||||||    **         |  |||       | |||          | |||||  |  | |  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..              | |      | |            |||||||               |  |||       *****          | |||||  |  | |  ||  |      || ||           |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |      | |            |||||||               |  |||       ****|          ****|||  **** ********      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              ***      ***            |||||||               |  |||         | |            |||||       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..                                      |******               |  |||         ***            *****       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ||                    ****||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  | |             | ||             ||||||||| |||| |  || |   | || |   | ||^***         | ||||| || ||||  ||  |      ||||||  ||      |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  | |             | ||             ||||||||**^*|| |  || |   | || |   | |||||          | ||||| || ||||  ||  |      ||||||  ||      |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  | |             | ||             ||||||||    || |  |^**   | || |   | |||||          | ||||| || ||||  ||  |      ||||||  ||      |  |      ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  | |             | ||             ||||||||    || |  |      | || |   ^***|||          ^***||| || ||||  ||  |      ||||||  ||      |  |         ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****             | ||             ||||||||    || |  |      ^*****     | |||            ||||| || ||||  ||  |      ||||||  ||      |  |                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |             | ||             ||||||||    || |  |        ||       | |||            ||||| |*****|  ||  |      |||||*****      |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |             | ||             ||||||||    || |  |        ||       | |||            ||||| || || |  ||  |      *****|  |       |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |             | ||             ||||||||    || |  |        ||       | |||            ||||| || || |  ||  |      ***|||  |       |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..    | |             | ||             ||||||||    ** |  |        ||       | |||            ||||| || || |  ||  |      || |||  |       |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    | |             | ||             ||||||||       |  |        ||       *****            ||||| || || |  ||  |      || |||  |       |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |             ****             ****||||       ****        ||       ****|            ||||| ***** ********      *********       |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..    | |             ***               |******                   ||         ***            *****       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                               ||                        ||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    | |   | || | | |               ||||||||| ||||  |  | | | |||| |   | ||^***         | ||||| |  |  |  ||  |      |||||           |  |      | ||  |   | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    | |   | || | | |               ||||||||**^*||  |  | | | |||| |   | |||||          | ||||| |  |  |  ||  |      |||||           |  |      | ||  |   | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    | |   | || | | |               ||||||||    ||  |  ^** | |||| |   | |||||          | ||||| |  |  |  ||  |      |||||           |  |      ^**|  |   | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    | |   | || | | |               ||||||||    ||  |  |   | |||| |   ^***|||          ^***||| |  |  |  ||  |      |||||           |  |         ^***   | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^***** |   | || | | |               ||||||||    ||  |  |   | ^*****     | |||          | ||||| |  |  |  ||  |      |||||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |   | || | | |               ||||||||    ||  |  |   |  |||       | |||          | ||||| |  |  |  ||  |      *****           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      | |   | || | | |               ||||||||    ||  |  |   |  |||       | |||          | ||||| |  |  |  ||  |      *****           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | |   | || | | |               ||||||||    ||  |  |   |  |||       | |||          | ||||| |  |  |  ||  |      ***||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |   | || | | |               ||||||||    **  |  |   |  |||       | |||          | ||||| |  |  |  ||  |      || ||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      | |   | || | | |               ||||||||        |  |   |  |||       *****          | ||||| |  |  |  ||  |      || ||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |   | || | | |               ****||||        ****   ****||       ****|          ****||| ****  ********      *****           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***   ****** | |                |||||||               |  |||         | |            |||||       |  ||  |                      |  |                | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***                |******               |  |||         ***            *****       |  ||  |                      |  |                | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ||                    ****||                                    ********                      ****                ***  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |     | |                      ||||||||| ||||     | | | |||| |   | ||^***         | ||||||  ||  |  ||  |      | |||           |  |      | ||  |||| |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |     | |                      ||||||||**^*||     | | | |||| |   | |||||          | ||||||  ||  |  ||  |      | |||           |  |      | ||  |||| |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |     | |                      ||||||||    ||     ^** | |||| |   | |||||          | ||||||  ||  |  ||  |      | |||           |  |      ^**|  |||| |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |     | |                      ||||||||    ||         | |||| |   ^***|||          ^***||||  ||  |  ||  |      | |||           |  |         ^***||| |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****     | |                      ||||||||    ||         | ^*****     | |||          | ||||||  ||  |  ||  |      | |||           |  |             ||| |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |                      ||||||||    ||         |  |||       | |||          | |||||*****  |  ||  |      *****           |  |             ||| |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            | |                      ||||||||    ||         |  |||       | |||          | ||||||  |   |  ||  |      *****           |  |             ||| |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..            | |                      ||||||||    ||         |  |||       | |||          | ||||||  |   |  ||  |      ***|            |  |             ||| |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | |                      ||||||||    **         |  |||       | |||          | ||||||  |   |  ||  |      |  |            |  |             ||| |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            | |                      ||||||||               |  |||       *****          | ||||||  |   |  ||  |      |  |            |  |             ||| |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |                      ****||||               ****||       ****|          ****|||****   ********      ****            |  |             ||| |   
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                       |******               |  |||         ***            *****       |  ||  |                      |  |             ||| |   
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ||                    ****||                                    ********                      ****             *****   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |         | || | | |           ||||||||| ||||  |  | | | |||| |   | ||^***         | |||||       |  ||  |      |||||           |  |      | ||  |   | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    |         | || | | |           ||||||||**^*||  |  | | | |||| |   | |||||          | |||||       |  ||  |      |||||           |  |      | ||  |   | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |    |         | || | | |           ||||||||    ||  |  ^** | |||| |   | |||||          | |||||       |  ||  |      |||||           |  |      ^**|  |   | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |         | || | | |           ||||||||    ||  |  |   | |||| |   ^***|||          ^***|||       |  ||  |      |||||           |  |         ^***   | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****         | || | | |           ||||||||    ||  |  |   | ^*****     | |||          | |||||       |  ||  |      |||||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | || | | |           ||||||||    ||  |  |   |  |||       | |||          | |||||       |  ||  |      *****           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | || | | |           ||||||||    ||  |  |   |  |||       | |||          | |||||       |  ||  |      *****           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | || | | |           ||||||||    ||  |  |   |  |||       | |||          | |||||       |  ||  |      ***||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | || | | |           ||||||||    **  |  |   |  |||       | |||          | |||||       |  ||  |      || ||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                | || | | |           ||||||||        |  |   |  |||       *****          | |||||       |  ||  |      || ||           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                | || | | |           ****||||        |  |   |  |||       ****|          ****|||       ********      *****           |  |                | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                | |*** ***            |||||||        |  |   |  |||         | |            |||||       |  ||  |                      |  |                ***  
search RasMol script viewer Motif-ligand binding stats  nest ..                | |                   |******        |  |   |  |||         ***            *****       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                ***                   ||             ****   ****||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || | ||||| | | | |||| |             ||||||||| ||||  | || |   | || |   | ||^***         | ||||||  ||  |  ||  |      | |||           |  |      | ||  |  | |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. || | ||||| | | | |||| |             ||||||||**^*||  | || |   | || |   | |||||          | ||||||  ||  |  ||  |      | |||           |  |      | ||  |  | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || | ||||| | | | |||| |             ||||||||    ||  | |^**   | || |   | |||||          | ||||||  ||  |  ||  |      | |||           |  |      ^**|  |  | |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. || | ||||| | | | |||| |             ||||||||    ||  | |      | || |   ^***|||          ^***||||  ||  |  ||  |      | |||           |  |         ^***  | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****|||| | | | |||| |             ||||||||    ||  | |      ^*****     | |||          | ||||||  ||  |  ||  |      | |||           |  |               | |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |  |||| | | | |||| |             ||||||||    ||  | |        ||       | |||          | |||||*****  |  ||  |      *****           |  |               | |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | |  |||| | | | |||| |             ||||||||    ||  | |        ||       | |||          | ||||||  |   |  ||  |      *****           |  |               | |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | |  |||| | | | |||| |             ||||||||    ||  | |        ||       | |||          | ||||||  |   |  ||  |      ***|            |  |               | |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..  | |  |||| | | | |||| |             ||||||||    **  | |        ||       | |||          | ||||||  |   |  ||  |      |  |            |  |               | |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  | |  |||| | | | |||| |             ||||||||        | |        ||       *****          | ||||||  |   |  ||  |      |  |            |  |               | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |  |||| | | | |||| |             ****||||        | |        ||       ****|          ****|||****   ********      ****            |  |               | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |  |||| *** ****** |              |||||||        ***        ||         | |            |||||       |  ||  |                      |  |               | |   
search RasMol script viewer Motif-ligand binding stats  nest ..  | |  ****         |  |              |******                   ||         ***            *****       |  ||  |                      |  |               | |   
search RasMol script viewer Motif-ligand binding stats  niche ..  ***               ****              ||                        ||                                    ********                      ****               ***   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

Assembly 1  model: 20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8
member of: GENE3D:searchG3DSA_3.10.50.40PANTHER:searchPTHR10516/searchPTHR10516_SF271PFAM:searchPF00254PROSITE PROFILES:searchPS50059, SUPERFAMILY:searchSSF54534UniProt:searchQ14318
sec str:  ......................................ee......eeeeeee.............eeeeeeeee......eeee..eeee......hhhhhhhh.......eeeeeee.hhh...............eeeeeeeeeeee.........
sequence :  ..MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  | |     | | ||||        | |       |||||||| ||||     | | | |||| |   | ||^***         | ||||||| ||  |  ||  |      | |||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  | |     | | ||||        | |       |||||||**^*||     | | | |||| |   | |||||          | ||||||| ||  |  ||  |      | |||           |  |      | ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  | |     | | ||||        | |       |||||||    ||     ^** | |||| |   | |||||          | ||||||| ||  |  ||  |      | |||           |  |      ^**|  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  | |     | | ||||        | |       |||||||    ||         | |||| |   ^***|||          ^***||||| ||  |  ||  |      | |||           |  |         ^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****     | | ||||        | |       |||||||    ||         | ^*****     | |||            ||||||| ||  |  ||  |      | |||           |  |                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |     | | ||||        | |       |||||||    ||         |  |||       | |||            |||||*****  |  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |     | | ||||        | |       |||||||    ||         |  |||       | |||            ||||||| ||  |  ||  |      *****           |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |     | | ||||        | |       |||||||    ||         |  |||       | ***            ||||||| ||  |  ||  |      ***|            |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..    | |     | | ||||        | |       |||||||    **         |  |||       | |||            ||||||| ||  |  ||  |      |  |            |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    | |     | | ||||        | |       |||||||               |  |||       *****            ||||||| ||  |  ||  |      |  |            |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     | | ||||        | |       |||||||               ****||       ****|            |||||*****  ********      ****            ****                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ***     | | ||||        | |       |||||||               |  |||         | |            |||||       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..            *** ****        | |       |******               |  |||         ***            *****       |  ||  |                      |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                            ***       ||                    ****||                                    ********                      ****                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                      **                        **                                                                                           

   New search    2mf9:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML