triangle PDBeMotif: 2lvm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification cell cycle    | release date: Sat, Jul 7, 2012
Title solution structure of human 53bp1 tandem tudor domains in co a histone h4k20me2 peptide
Authors G.CUI, G.MER, M.BOTUYAN
Method SOLUTION NMR
PDBe Citation   
Modified residues:  search MLY MLY binding statistics MLY
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKG
HRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Chain B sequence:
GAKRHRKVLRDNIQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |             | |          |  | |||    || ||      |  |     | |||   |    |**^* |  |   |  |    || ||  |  ||  ||||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |             ^**          |  | |||    || ||      |  |     | |||   |    | ||  |  |   |  |    || ||  |  ||  ||||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |                          |  | |||    || ||      |  |     ^***|   |    | ||  |  |   |  |    || ||  |  ||  ||||||  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |                          *******^    || ||      |  |       | |   |    | *******^   |  |    || ||  |  ||  ||||||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |                             | |||    || ||      |  |       | |   ^*****  |  |      |  |    || ||  |  ||  ||||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |                             | |||    || ||      |  |       | |           |  |      |  |    *****  ************|  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    ||| |                             | ***    || ||      |  |       | |           |  |      |  |    || ||  |  ||  | || |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ||| |                             ****|    *****      ****       | |           ****      ****    *****  *********** |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |      |  |       | |                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                        ****           ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  .......eee......
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****      | |
search RasMol script viewer Motif-ligand binding stats  nest ..           ***

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |             | |   | |    |  | |||     |  |  | | |  |     | |||   |    |**^* |  |           || ||      |  |||  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |             ^**   | |    |  | |||     |  |  | | |  |     | |||   |    | ||  |  |           || ||      |  |||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |                   | |    |  | |||     |  |  | | |  |     ^***|   |    | ||  |  |           || ||      |  |||  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |                   | |    *******^     |  |  | | |  |       | |   |    | *******^           || ||      |  |||  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |                   | |       | |||     |  |  | | |  |       | |   ^*****  |  |              || ||      |  |||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |                   | |       | |||     |  |  | | |  |       | |           |  |              *****      *****|  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    ||| |                   ***       | |||     |  |  | | |  |       | |           |  |              || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |****                             ****|     ****  | | ****       | |           ****              *****      **** |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |  | | |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |  | | |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****  *** ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ................
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |  |             | |   | |    |  | |||     |  |      |  |     | |||   |    |**^* |  |           || ||   || || |||  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |  |             ^**   | |    |  | |||     |  |      |  |     | |||   |    | ||  |  |           || ||   || || |||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |  |                   | |    |  | |||     |  |      |  |     ^***|   |    | ||  |  |           || ||   || || |||  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | |  |                   | |    *******^     |  |      |  |       | |   |    | *******^           || ||   || || |||  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |  |                   | |       | |||     |  |      |  |       | |   ^*****  |  |              || ||   || || |||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |  |                   | |       | |||     |  |      |  |       | |           |  |              *****   || *****|  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ***  |                   ***       | |||     |  |      |  |       | |           |  |              || ||   || || | |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****                             ****|     ****      |  |       | |           ****              *****   ******* |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                        ****           ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ....eee.........
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |             | |          |  | |||     |  |      |  |     | |||   |    |**^* |  |   |  |    || ||  |  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |             ^**          |  | |||     |  |      |  |     | |||   |    | ||  |  |   |  |    || ||  |  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |                          |  | |||     |  |      |  |     ^***|   |    | ||  |  |   |  |    || ||  |  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |                          *******^     |  |      |  |       | |   |    | *******^   |  |    || ||  |  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |                             | |||     |  |      |  |       | |   ^*****  |  |      |  |    || ||  |  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |                             | |||     |  |      |  |       | |           |  |      |  |    *****  *****    |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |****                             ****|     ****      ****       | |           ****      ****    *****  ****     |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |      |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ................
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |  |             | |   | |    |  | |||     |  |      |  |     | |||   |    |**^* |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |  |             ^**   | |    |  | |||     |  |      |  |     | |||   |    | ||  |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |  |                   | |    |  | |||     |  |      |  |     ^***|   |    | ||  |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | |  |                   | |    *******^     |  |      |  |     | |||   |    | *******^   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |  |                   | |       | |||     |  |      |  |     | |||   ^*****  |  |      |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |  |                   | |       | |||     |  |      |  |     | |||           |  |      |  |    *****    *****  |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |  |                   ***       | |||     |  |      |  |     | |||           |  |      |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | |  |                             | |||     |  |      |  |     *****           |  |      |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |  |                             ****|     ****      ****     ****|           ****      ****    *****    ****   |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ***  |                               | |     |  |      |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ................
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |||| |     | |||   | |   | |    |  | |||    || ||      |  |     | |||   |    |**^* |  |   |  |    || ||    | ||||||  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |||| |     | |||   ^**   | |    |  | |||    || ||      |  |     | |||   |    | ||  |  |   |  |    || ||    | ||||||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |||| |     | |||         | |    |  | |||    || ||      |  |     ^***|   |    | ||  |  |   |  |    || ||    | ||||||  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   |||| |     | |||         | |    *******^    || ||      |  |       | |   |    | *******^   |  |    || ||    | ||||||  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |||| |     | |||         | |       | |||    || ||      |  |       | |   ^*****  |  |      |  |    || ||    | ||||||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |||| |     | |||         | |       | |||    || ||      |  |       | |           |  |      |  |    *****    *******|  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |||| |     | |||         ***       | |||    || ||      |  |       | |           |  |      |  |    || ||    | || | |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |||| |     ****|                   ****|    *****      ****       | |           ****      ****    *****    ****** |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   **** |       | |                     | |     |  |      |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |       ***                     ***     |  |      |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ....eee.........
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |     |  ||   | |          |  | |||    || ||      |  |     | |||   |    |**^*    |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |     |  ||   ^**          |  | |||    || ||      |  |     | |||   |    | |      |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |     |  ||                |  | |||    || ||      |  |     ^***|   |    | |      |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |     |  ||                *******^    || ||      |  |     | |||   |    | *******^   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |     |  ||                   | |||    || ||      |  |     | |||   ^*****            |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |     *****                   | |||    || ||      |  |     | |||                     |  |    *****    *****  |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    ||| |     |  |                    | |||    || ||      |  |     *****                     |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ||| |     ****                    ****|    *****      ****     ****|                     ****    *****    ****   |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |      |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ................
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****| |  | | 
search RasMol script viewer Motif-ligand binding stats  nest ..     | |  *** 
search RasMol script viewer Motif-ligand binding stats  niche ..     ***      

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |     |  ||   | |          |  | |||     |  |      |  |     | |||   |    |**^* |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |     |  ||   ^**          |  | |||     |  |      |  |     | |||   |    | ||  |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |     |  ||                |  | |||     |  |      |  |     ^***|   |    | ||  |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |     |  ||                *******^     |  |      |  |     | |||   |    | *******^   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |     |  ||                   | |||     |  |      |  |     | |||   ^*****  |  |      |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |     *****                   | |||     |  |      |  |     | |||           |  |      |  |    *****    *****  |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    ||| |     |  |                    | ***     |  |      |  |     | |||           |  |      |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    ||| |     |  |                    | |||     |  |      |  |     *****           |  |      |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |****     ****                    ****|     ****      ****     ****|           ****      ****    *****    ****   |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |      |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ...........eee..
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |             | |   | |    |  | |||     |  |  | | |  |     | |||   |    |**^*    |   |  |    || ||    |  ||||||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |             ^**   | |    |  | |||     |  |  | | |  |     | |||   |    | |      |   |  |    || ||    |  ||||||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |                   | |    |  | |||     |  |  | | |  |     ^***|   |    | |      |   |  |    || ||    |  ||||||||  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |                   | |    *******^     |  |  | | |  |       | |   |    | *******^   |  |    || ||    |  ||||||||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |                   | |       | |||     |  |  | | |  |       | |   ^*****            |  |    || ||    |  ||||||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |                   | |       | |||     |  |  | | |  |       | |                     |  |    *****    **********|  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    ||| |                   ***       | |||     |  |  | | |  |       | |                     |  |    || ||    |  | |||| |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |****                             ****|     ****  | | |  |       | |                     ****    *****    ********* |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |  | | |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |  | | |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****  *** ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ............hhhh
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****| |  |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |  ****
search RasMol script viewer Motif-ligand binding stats  niche ..     ***      

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |  |             | |   | |    |  | |||     |  |      |  |     | |||   |    |**^* |  |            |  |    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |  |             ^**   | |    |  | |||     |  |      |  |     | |||   |    | ||  |  |            |  |    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |  |                   | |    |  | |||     |  |      |  |     ^***|   |    | ||  |  |            |  |    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | |  |                   | |    *******^     |  |      |  |     | |||   |    | *******^            |  |    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |  |                   | |       | |||     |  |      |  |     | |||   ^*****  |  |               |  |    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |  |                   | |       | |||     |  |      |  |     | |||           |  |               |  |    *****  |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ***  |                   ***       | |||     |  |      |  |     | |||           |  |               |  |    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     |  |                             | |||     |  |      |  |     *****           |  |               |  |    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****                             ****|     ****      ****     ****|           ****               ****    ****   |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  .......eee......
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |  |             | |   | |    |  | |||    || ||  | | |  |     | |||   |    |**^*    |           || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |  |             ^**   | |    |  | |||    || ||  | | |  |     | |||   |    | |      |           || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |  |                   | |    |  | |||    || ||  | | |  |     ^***|   |    | |      |           || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | |  |                   | |    *******^    || ||  | | |  |     | |||   |    | *******^           || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |  |                   | |       | |||    || ||  | | |  |     | |||   ^*****                    || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |  |                   | |       | |||    || ||  | | |  |     | |||                             *****           |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |  |                   ***       | |||    || ||  | | |  |     | |||                             || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | |  |                             | |||    || ||  | | |  |     *****                             || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | ****                             ****|    *****  | | ****     ****|                             *****           |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ***  |                               | |     |  |  | | |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |  | | |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****  *** ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ................
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |             | |   | |    |  | |||     |  |      |  |     | |||   |    |**^*    |   |  |    || ||       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |             ^**   | |    |  | |||     |  |      |  |     | |||   |    | |      |   |  |    || ||       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |                   | |    |  | |||     |  |      |  |     ^***|   |    | |      |   |  |    || ||       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |                   | |    *******^     |  |      |  |       | |   |    | *******^   |  |    || ||       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |                   | |       | |||     |  |      |  |       | |   ^*****            |  |    || ||       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |                   | |       | |||     |  |      |  |       | |                     |  |    *****       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    ||| |                   ***       | |||     |  |      |  |       | |                     |  |    || ||       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |****                             ****|     ****      ****       | |                     ****    *****       ****|  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |      |  |       | |                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                        ****           ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ................
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |  |             | |   | |    |  | |||    || ||      |  |     | |||   |    |**^*    |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |             ^**   | |    |  | |||    || ||      |  |     | |||   |    | |      |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |                   | |    |  | |||    || ||      |  |     ^***|   |    | |      |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |                   | |    *******^    || ||      |  |       | |   |    | *******^   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |                   | |       | |||    || ||      |  |       | |   ^*****            |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |                   | |       | |||    || ||      |  |       | |                     |  |    *****    *****  |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |                   ***       | |||    || ||      |  |       | |                     |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |                             ****|    *****      ****       | |                     ****    *****    ****   |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                        ****           ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ................
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |             | |   | |    |    | |     |  |  | | |  |     | |||   |    |**^* |  |   |  |    || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |             ^**   | |    |    | |     |  |  | | |  |     | |||   |    | ||  |  |   |  |    || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |                   | |    |    | |     |  |  | | |  |     ^***|   |    | ||  |  |   |  |    || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |                   | |    *******^     |  |  | | |  |       | |   |    | *******^   |  |    || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |                   | |         | |     |  |  | | |  |       | |   ^*****  |  |      |  |    || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |                   | |         | |     |  |  | | |  |       | |           |  |      |  |    *****           |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    ||| |                   ***         | |     |  |  | | |  |       | |           |  |      |  |    || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |****                               | |     ****  | | ****       | |           ****      ****    *****           |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |  | | |  |       | |                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |  | | |  |       ***                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****  *** ****                                        ****           ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ....eee.........
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****     |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****

Assembly 1  model: 15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |             | |          |  | |||     |  |  | | |  |     | |||   |    |**^*    |           || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |             ^**          |  | |||     |  |  | | |  |     | |||   |    | |      |           || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |                          |  | |||     |  |  | | |  |     ^***|   |    | |      |           || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |                          *******^     |  |  | | |  |       | |   |    | *******^           || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |                             | |||     |  |  | | |  |       | |   ^*****                    || ||           |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |                             | |||     |  |  | | |  |       | |                             *****           |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ||| |                             ****|     ****  | | ****       | |                             *****           |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |  | | |  |       | |                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |  | | |  |       ***                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****  *** ****                                        ****           ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ................
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |             | |          |  | |||     |  |      |  |     | |||   |    |**^* |  |   |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |             ^**          |  | |||     |  |      |  |     | |||   |    | ||  |  |   |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |                          |  | |||     |  |      |  |     ^***|   |    | ||  |  |   |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |                          *******^     |  |      |  |       | |   |    | *******^   |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |                             | |||     |  |      |  |       | |   ^*****  |  |      |  |    || ||    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |                             | |||     |  |      |  |       | |           |  |      |  |    *****    |  |   |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |****                             ****|     ****      ****       | |           ****      ****    *****    ****   |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |      |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ................
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |  |             | |          |  | |||     |  |      |  |     | |||   |    |**^*    |   |  |    || ||    |  |  ||  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |             ^**          |  | |||     |  |      |  |     | |||   |    | |      |   |  |    || ||    |  |  ||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |                          |  | |||     |  |      |  |     ^***|   |    | |      |   |  |    || ||    |  |  ||  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |                          *******^     |  |      |  |     | |||   |    | *******^   |  |    || ||    |  |  ||  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |                             | |||     |  |      |  |     | |||   ^*****            |  |    || ||    |  |  ||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |                             | |||     |  |      |  |     | |||                     |  |    *****    |  |  ||  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |                             | ***     |  |      |  |     | |||                     |  |    || ||    |  |  ||  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     |  |                             | |||     |  |      |  |     *****                     |  |    || ||    |  |  ||  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****                             ****|     ****      ****     ****|                     ****    *****    *******|  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  .......eee......
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |             | |          |  | |||    || ||      |  |     | |||   |    |**^* |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |             ^**          |  | |||    || ||      |  |     | |||   |    | ||  |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |                          |  | |||    || ||      |  |     ^***|   |    | ||  |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |                          *******^    || ||      |  |       | |   |    | *******^   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |                             | |||    || ||      |  |       | |   ^*****  |  |      |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |                             | |||    || ||      |  |       | |           |  |      |  |    *****    *****  |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |****                             ****|    *****      |  |       | |           ****      ****    *****    ****   |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |      |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ....eee.........
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****     ||||
search RasMol script viewer Motif-ligand binding stats  nest ..          ****

Assembly 1  model: 19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |        | |  | |          |  | |||     |  |      |  |     | |||   |    |**^* |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |        | |  ^**          |  | |||     |  |      |  |     | |||   |    | ||  |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |        | |               |  | |||     |  |      |  |     ^***|   |    | ||  |  |   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |        | |               *******^     |  |      |  |       | |   |    | *******^   |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |        | |                  | |||     |  |      |  |       | |   ^*****  |  |      |  |    || ||    |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |        | |                  | |||     |  |      |  |       | |           |  |      |  |    *****    *****  |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ||| |        | |                  ****|     ****      ****       | |           ****      ****    *****    ****   |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |        ***                    | |     |  |      |  |       | |                                             |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                                             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                                       ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  .......eee......
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

Assembly 1  model: 20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
sec str:  ...........eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeee...eee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..-3        1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||| |             | |   | |    |  | |||     |  |      |  |     | |||   |    |**^*    |   |  |    || ||      |  |||  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ||| |             ^**   | |    |  | |||     |  |      |  |     | |||   |    | |      |   |  |    || ||      |  |||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||| |                   | |    |  | |||     |  |      |  |     ^***|   |    | |      |   |  |    || ||      |  |||  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||| |                   | |    *******^     |  |      |  |       | |   |    | *******^   |  |    || ||      |  |||  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |                   | |       | |||     |  |      |  |       | |   ^*****            |  |    || ||      |  |||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||| |                   | |       | |||     |  |      |  |       | |                     |  |    *****      *****|  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    ||| |                   ***       | ***     |  |      |  |       | |                     |  |    || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |****                             ****|     ****      |  |       | |                     ****    *****      **** |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |                               | |     |  |      |  |       | |                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                               ***     |  |      |  |       ***                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                       ****      ****                                        ****           ****  

chain B : HISTONE H4
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4PROSITE PATTERNS:searchPS00047, SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ....eee.........
sequence :  ..GAKRHRKVLRDNIQ
seq num:  ..14        24  
search RasMol script viewer Motif-ligand binding stats  HISTONE_H4 ..*****         

   New search    2lvm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML