triangle PDBeMotif: 2ld1  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification metal binding protein    | release date: Fri, May 13, 2011
Title structures and chemical shift assignments for the add domain atrx protein
Authors D.NEUHAUS, J.YANG
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDF
CHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  || ||  |    | |        |||||    |  | |          | || | ^***          | |   || ||| ^***||         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  || ||  |    | |        ||||^*****  | |          | || | |  |          | |   || |||  || ||         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  || ||  |    | |        ||||        | |          ^*** | |  |          | |   || |||  || ||         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  || ||  |    | |        ||||        | |            |  | |  |          | |   || |||  || ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  ***** ||  |    | |        ||||        | |            |  | |  |          | |   |*****  || ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  *******|  |    | |        ||||        | |            **** ****          | |   *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |    ***        ||||        | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |               ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  || ||  |   | |         |||||    |  | |      |  ||  |   ^***          | |   || ||| ^*** |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  || ||  |   | |         ||||^*****  | |      |  ||  |   |  |          | |   || |||  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  || ||  |   | |         ||||        | |      |  |^***   |  |          | |   || |||  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  || ||  |   | |         ||||        | |      |  ||      |  |          | |   || |||  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  ***** ||  |   | |         ||||        | |      *****      |  |          | |   |*****  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  *******|  |   | |         ||||        | |      ****       ****          | |   *************  ****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |   | |         ||||        | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |   ***         ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | | | ||   | ||| | |           | |  |  || ||  |    | | |      | | |    |  | |          |  || |^***          | |    |  || ^*** |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | | | ^***** |^*****           | |  |  || ||  |    | | |      | | ^*****  | |          |  || ||| |          | |    |  ||  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | | |  |     | | | |           | |  |  || ||  |    | | |      | |         | |          ^***| ||| |          | |    |  ||  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      *** |  |     | | | |           | |  |  || ||  |    | | |      | |         | |             || ||| |          | |    |  ||  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |     | | | |           | |  ***** ||  |    | | |      | |         | |             |***** |          | |    *****  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |     | | | |           | |  *******|  |    | | |      | |         | |             ********          | |    ************  ****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  |     | | ***           | |         |  |    *** |      | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |     ***               ***         |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                                   ****                                                                                         

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  || ||  |    | |        |||||    |  | |      |  || || | ^***          | |   || ||| ^*** |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  || ||  |    | |        ||||^*****  | |      |  || || | |  |          | |   || |||  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  || ||  |    | |        ||||        | |      |  |^*** | |  |          | |   || |||  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  || ||  |    | |        ||||        | |      |  || |  | |  |          | |   || |||  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  ***** ||  |    | |        ||||        | |      ***** |  | |  |          | |   |*****  ||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  *******|  |    | |        ||||        | |      ****  **** ****          | |   *************  ****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |    ***        ||||        | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |               ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  || ||  |      | |      |||||    |  | |          | || | ^***          | |  | | ||| ^***|| |||     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  || ||  |      | |      ||||^*****  | |          | || | |  |          | |  | | |||  || || |||     
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  || ||  |      | |      ||||        | |          ^*** | |  |          | |  | | |||  || || |||     
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  || ||  |      | |      ||||        | |            |  | |  |          | |  | | |||  || || |||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  ***** ||  |      | |      ||||        | |            |  | |  |          | |  | *****  || ******     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  *******|  |      | |      ||||        | |            **** ****          | |  | ***************      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |      | |      ||||        | |                               ***  |   |                  
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ****        ***                                    |   |                  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                  |   |                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                       *****                  

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  || ||  |    | | |      | | |    |  | |      |  || || ||^***                || ||| ^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  || ||  |    | | |      | | ^*****  | |      |  || || |||  |                || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  || ||  |    | | |      | |         | |      |  |^*** |||  |                || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  || ||  |    | | |      | |         | |      |  || || |||  |                || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  ********  |    | | |      | |         | |      ***** || |||  |                || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  *******|  |    | | |      | |         | |      ****  *********                *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |    *** |      | |         | |                                                           
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  || ||  |    | |        |||||    |  | |          |  |   ^***          | | |  || || ^***           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  || ||  |    | |        ||||^*****  | |          |  |   |  |          | | |  || || ||             
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  || ||  |    | |        ||||        | |          ^***   |  |          | | |  || || ||             
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  || ||  |    | |        ||||        | |                 |  |          | | |  || || ||             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  ***** ||  |    | |        ||||        | |                 |  |          | | ***********             
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  *******|  |    | |        ||||        | |                 ****          | | ***********             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |    ***        ||||        | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |               ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  || ||  |      ||||     |||||    |  | |          | || | ^***          | |   || ||| ^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  || ||  |      ||||     ||||^*****  | |          | || | |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  || ||  |      ||||     ||||        | |          ^*** | |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  || ||  |      ||||     ||||        | |            |  | |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  ***** ||  |      ||||     ||||        | |            |  | |  |          | |   |*****  ||  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  *******|  |      ||||     ||||        | |            **** ****          | |   *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |      ||||     ||||        | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ****     ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  ||  |  |    | | |      |||||    |  | |      |  ||  |  |^***          | |   || ||| ^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  ||  |  |    | | |      ||||^*****  | |      |  ||  |  ||  |          | |   || ||| |||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  ||  |  |    | | |      ||||        | |      |  |^***  ||  |          | |   || ||| |||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  ||  |  |    | | |      ||||        | |      |  ||  |  ||  |          | |   || ||| |||  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  *****  |  |    | | |      ||||        | |      *****  |  ||  |          | |   |*********  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |    | | |      ||||        | |      ****   ********          | |   *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |    *** |      ||||        | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |   || ||| | |           | |  |  || ||  |      | |      | | |    |  | |          | || | ^***          | |   || ||| ^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  || ||  |      | |      | | ^*****  | |          | || | |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |       |  | | | |           | |  |  || ||  |      | |      | |         | |          ^*** | |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***       |  | | | |           | |  |  || ||  |      | |      | |         | |            |  | |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                |  | | | |           | |  ***** ||  |      | |      | |         | |            |  | |  |          | |   |*********  |         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                ****** | |           | |  |  |  ||  |      | |      | |         | |            |  | |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  *******|  |      | |      | |         | |            **** ****          | |   *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |      | |      | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | |||   |           | |  |  ||  |  |    | |        | | |    |  | |      |  ||  ||  ^***          | | | |||||| ^***||      | |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  ||  |  |    | |        | | ^*****  | |      |  ||  ||  || |          | | | ||||||  || ||      | |
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | |               | |  |  ||  |  |    | |        | |         | |      |  |^***|  || |          | | | ||||||  || ||      | |
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | |               | |  |  ||  |  |    | |        | |         | |      |  ||   |  || |          | | | ||||||  || ||      | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | |               | |  *****  |  |    | |        | |         | |      *****   ***** |          | | ********  || ||      | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | |               | |  ****   |  |    | |        | |         | |      ****    *******          | | ***************      | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | |               | |         |  |    ***        | |         | |                               ***                      | |
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |               ***         ***                                                        ***
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  ||  |  |      | |      |||||    |  | |      |  ||  |   ^***          | |   || ||| ^*** ||  || |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  ||  |  |      | |      ||||^*****  | |      |  ||  |   |  |          | |   || ||| |||  ||  || |  
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  ||  |  |      | |      ||||        | |      |  |^***   |  |          | |   || ||| |||  ||  || |  
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  ||  |  |      | |      ||||        | |      |  ||      |  |          | |   || ||| |||  ||  || |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  *****  |  |      | |      ||||        | |      *****      |  |          | |   |***** |||  |***** |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |      | |      ||||        | |      ****       ****          | |   *****************| |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |      | |      ||||        | |                               ***                    | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ****        ***                                                      ***  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  |   |  |    | | |      | | |    |  | |      |  || || ||^***          | |   |||||| ^*** || ||||   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  |   |  |    | | |      | | ^*****  | |      |  || || |||  |          | |   ||||||  ||  || ||||   
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  |   |  |    | | |      | |         | |      |  |^*** |||  |          | |   ||||||  ||  || ||||   
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  |   |  |    | | |      | |         | |      |  || || |||  |          | |   ||||||  ||  || ||||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  |  |   |  |    | | |      | |         | |      ***** || |||  |          | |   ||||||  ||  |*****|   
search RasMol script viewer Motif-ligand binding stats  asxturn ..                   | | | |           | |  |  |   |  |    *** |      | |         | |      |  |  || |||  |          | |   ||||||  ||  || || |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |      | |      | |         | |      ****  *********          | |   *******************   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |      | |      | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  |   |  |    | |        |||||    |  | |      |  || || | ^***          | |  ||||||| ^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  |   |  |    | |        ||||^*****  | |      |  || || | |  |          | |  ||||||| |||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  |   |  |    | |        ||||        | |      |  |^*** | |  |          | |  ||||||| |||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  |   |  |    | |        ||||        | |      |  || |  | |  |          | |  ||||||| |||  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  |  |   |  |    | |        ||||        | |      ***** |  | |  |          | |  ||********|  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |    | |        ||||        | |      ****  **** ****          | |  **************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |    ***        ||||        | |                               ***  |   |                  
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |               ****        ***                                    |   |                  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                  |   |                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                       *****                  

Assembly 1  model: 15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | |||   |           | |  |  ||  |  |      | |      | | |    |  | |          |  |   ^***                || ||| ^***||  ||     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  ||  |  |      | |      | | ^*****  | |          |  |   |  |                || |||  || ||  ||     
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | |               | |  |  ||  |  |      | |      | |         | |          ^***   |  |                || |||  || ||  ||     
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | |               | |  |  ||  |  |      | |      | |         | |                 |  |                || |||  || ||  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | |               | |  *****  |  |      | |      | |         | |                 |  |                |*****  || |*****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | |               | |  ****   |  |      | |      | |         | |                 ****                ****************      
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |                |  || ||  |    | | |      |||||    |  | |          | || | ^***          | |   | || | ^***||  ||     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****                |  || ||  |    | | |      ||||^*****  | |          | || | |  |          | |   | || |  || ||  ||     
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |                |  || ||  |    | | |      ||||        | |          ^*** | |  |          | |   | || |  || ||  ||     
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |                |  || ||  |    | | |      ||||        | |            |  | |  |          | |   | || |  || ||  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |                ***** ||  |    | | |      ||||        | |            |  | |  |          | |   | || |  || |*****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |                *******|  |    | | |      ||||        | |            **** ****          | |   ****************      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***                       |  |    *** |      ||||        | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***                           |  |      ***      ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  || ||  |      | |      | | |    |  | |          | || ||^***          | |   || ||| ^***||         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  || ||  |      | |      | | ^*****  | |          | || |||  |          | |   || |||  || ||         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  || ||  |      | |      | |         | |          ^*** |||  |          | |   || |||  || ||         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  || ||  |      | |      | |         | |            || |||  |          | |   || |||  || ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  ***** ||  |      | |      | |         | |            || |||  |          | |   |*****  || ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  *******|  |      | |      | |         | |            *********          | |   *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |      | |      | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | | | |    | |||   | |         | |  |  || ||  |    | |        | | |    |  | |          |  |   ^***          | |   || ||| ^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | | | ^***** |^***** |         | |  |  || ||  |    | |        | | ^*****  | |          |  |   |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | | |        | |   | |         | |  |  || ||  |    | |        | |         | |          ^***   |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      *** |        | |   | |         | |  |  || ||  |    | |        | |         | |                 |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |        | |   | |         | |  ***** ||  |    | |        | |         | |                 |  |          | |   |*********  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |        | |   | |         | |  *******|  |    | |        | |         | |                 ****          | |   *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ***        | |   ***         | |         |  |    ***        | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |               ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |        || |||  |  |  ||  |      | |      | | |    |  | |          | || | ^***          | |   || ||| ^*** |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****        || |||  |  |  ||  |      | |      | | ^*****  | |          | || |               | |   || ||| |||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |        || |||  |  |  ||  |      | |      | |         | |          ^*** |               | |   || ||| |||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |        || |||  |  |  ||  |      | |      | |         | |            |  |               | |   || ||| |||  |  |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |        || |||  |  |  ||  |      | |      | |         | |            |  |               | |   |********|  |  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |        |****|  *******|  |      | |      | |         | |            ****               | |   *************  ****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***        |  | |         |  |      | |      | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***            |  ***         |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                  |    |         ****                                                                                         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                  ******                                                                                                      

Assembly 1  model: 20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | |||   |           | |  |  |   |  |      | |      | | |    |  | |      |  ||  |   ^***          | |   | || | ^***||  |  ||  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  |   |  |      | |      | | ^*****  | |      |  ||  |   |  |          | |   | || |  || ||  |  ||  
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | |               | |  |  |   |  |      | |      | |         | |      |  |^***   |  |          | |   | || |  || ||  |  ||  
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | |               | |  |  |   |  |      | |      | |         | |      |  ||      |  |          | |   | || |  || ||  |  ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |          | |               | |  |  |   |  |      | |      | |         | |      *****      |  |          | |   | || |  || ||  *****  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |          | |               | |  ****   |  |      | |      | |         | |      ****       ****          | |   *************  ****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |          | |               | |         |  |      | |      | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..      ***          ***               ***         |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 21     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  ||  |  |  | | ||||     | | |    |  | |          | || | ^***          | |   || ||| ^***|||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  ||  |  |  | | ||||     | | ^*****  | |          | || |  |            | |   || |||  || |||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  ||  |  |  | | ||||     | |         | |          ^*** |  |            | |   || |||  || |||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  ||  |  |  | | ||||     | |         | |            |  |  |            | |   || |||  || |||  ||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  *****  |  |  | | ||||     | |         | |            |  |  |            | |   |*****  || ||*****    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |  | | ||||     | |         | |            *******            | |   *****************     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |  | | ||||     | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |  | | ****     ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****  ***                                                                                    

Assembly 1  model: 22     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..   |||| |   |    | ||| | |           | |  |  |   |  |    | |        | | |    |  | |          | || | ^***          | |   |  | ||^*** ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00008 ..   |||| |   ^***** |^*****           | |  |  |   |  |    | |        | | ^*****  | |          | || | |  |          | |   |  | || ||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00009 ..   |||| |          | | | |           | |  |  |   |  |    | |        | |         | |          ^*** | |  |          | |   |  | || ||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00016 ..   |||***          | | | |           | |  |  |   |  |    | |        | |         | |            |  | |  |          | |   |  | || ||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||||            | | | |           | |  |  |   |  |    | |        | |         | |            |  | |  |          | |   |  | || ||  |*****    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ||||            | | | |           | |  ****   |  |    | |        | |         | |            **** ****          | |   *****************     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ||||            | | ***           | |         |  |    ***        | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..   ****            ***               ***         |  |               ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 23     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |   || ||| | |           | |  |  ||  |  |    | |        | | |    |  | |      |  ||  |   ^***          | |        | ^*** ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  ||  |  |    | |        | | ^*****  | |      |  ||  |   |  |          | |        |  ||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |       |  | | | |           | |  |  ||  |  |    | |        | |         | |      |  |^***   |  |          | |        |  ||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***       |  | | | |           | |  |  ||  |  |    | |        | |         | |      |  ||      |  |          | |        |  ||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                |  | | | |           | |  *****  |  |    | |        | |         | |      *****      |  |          | |        |  ||  |*****    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                ****** | |           | |  |  |   |  |    | |        | |         | |      |  |       |  |          | |        |  ||  ||  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |    | |        | |         | |      ****       ****          | |        ************     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |    ***        | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |               ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 24     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  ||  |  |    | ||||     | | |    |  | |          | || | ^***          | |   |  ||||^*** ||||||||| 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  ||  |  |    | ||||     | | ^*****  | |          | || | |  |          | |   |  |||||||  ||||||||| 
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  ||  |  |    | ||||     | |         | |          ^*** | |  |          | |   |  |||||||  ||||||||| 
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  ||  |  |    | ||||     | |         | |            |  | |  |          | |   |  |||||||  ||||||||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  *****  |  |    | ||||     | |         | |            |  | |  |          | |   |  ******|  |||*****| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |    | ||||     | |         | |            **** ****          | |   ******************* | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |    ***|||     | |         | |                               ***                     | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ****     ***         ***                                                       *** 
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 25     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | | | |    | |||   |                |  ||  |  |      | |      | | |    |  | |      |  ||  |   ^***          | |    |  || ^*** ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | | | ^***** |^*****                |  ||  |  |      | |      | | ^*****  | |      |  ||  |   |  |          | |    |  || |||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | | | |      | |                    |  ||  |  |      | |      | |         | |      |  |^***   |  |          | |    |  || |||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      *** | |      | |                    |  ||  |  |      | |      | |         | |      |  ||      |  |          | |    |  || |||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |      | |                    *****  |  |      | |      | |         | |      *****      |  |          | |    ********|  |*****    
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |      | |                    ****   |  |      | |      | |         | |      ****       ****          | |    ****************     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |      | |                           |  |      | |      | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..          ***      ***                           |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 26     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  |   |  |      | |      | | |    |  | |          | || ||^***          | |   || ||||^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  |   |  |      | |      | | ^*****  | |          | || |||| |          | |   || |||||||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  |   |  |      | |      | |         | |          ^*** |||| |          | |   || |||||||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  |   |  |      | |      | |         | |            || |||| |          | |   || |||||||  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  |  |   |  |      | |      | |         | |            || |||| |          | |   |*********  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |      | |      | |         | |            *********          | |   *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |      | |      | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 27     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |   | |     | |  |  || ||  |      | |      |||||    |  | |      |  || || | ^***          | |   || ||| ^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****   | |     | |  |  || ||  |      | |      ||||^*****  | |      |  || || | |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |   | |     | |  |  || ||  |      | |      ||||        | |      |  |^*** | |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |   | |     | |  |  || ||  |      | |      ||||        | |      |  || |  | |  |          | |   || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |   | |     | |  ********  |      | |      ||||        | |      ***** |  | |  |          | |   |*****  ||  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |   | |     | |  *******|  |      | |      ||||        | |      ****  **** ****          | |   *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***   | |     | |         |  |      | |      ||||        | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***       ***     ***         |  |      ***      ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 28     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  |   |  |      | |      |||||    |  | |          |  |   ^***          | |   || ||  ^*** |  ||     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  |   |  |      | |      ||||^*****  | |          |  |                 | |   || ||    |  |  ||     
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  |   |  |      | |      ||||        | |          ^***                 | |   || ||    |  |  ||     
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  |   |  |      | |      ||||        | |                               | |   || ||    |  |  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  |  |   |  |      | |      ||||        | |                               | |   || ||    |  *****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |      | |      ||||        | |                               | |   *****    *******      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |      | |      ||||        | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 29     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  || ||  |    | | |      | | |    |  | |      |  ||  |  |^***|         | |   || ||| ^*** ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  || ||  |    | | |      | | ^*****  | |      |  ||  |  || |||         | |   || |||  ||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  || ||  |    | | |      | |         | |      |  |^***  || |||         | |   || |||  ||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  || ||  |    | | |      | |         | |      |  ||  |  || |||         | |   || |||  ||  ||  ||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  ***** ||  |    | | |      | |         | |      *****  |  || |||         | |   |*****  ||  |*****    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  *******|  |    | | |      | |         | |      ****   ********|         | |   *****************     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |    *** |      | |         | |                   ***         ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |      ***      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 30     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |           | |  |  |   |  |    | |        |||||    |  | |          | || | ^***                || ||| ^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  |   |  |    | |        ||||^*****  | |          | || | |  |                || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |           | |  |  |   |  |    | |        ||||        | |          ^*** | |  |                || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |           | |  |  |   |  |    | |        ||||        | |            |  | |  |                || |||  ||  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |           | |  |  |   |  |    | |        ||||        | |            |  | |  |                |*********  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |    | |        ||||        | |            **** ****                *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |    | |        ||||        | |                                                           
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |    ***        ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 31     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |   || ||| | |           | |  |  ||  |  |   |||| |      | | |    |  | |          | || | ^***          | |   |  |  |^*** | |  |    
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****           | |  |  ||  |  |   |||| |      | | ^*****  | |          | || | |  |          | |   |  |  |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |       |  | | | |           | |  |  ||  |  |   |||| |      | |         | |          ^*** | |  |          | |   |  |  |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***       |  | | | |           | |  |  ||  |  |   |||| |      | |         | |            |  | |  |          | |   |  |  |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                |  | | | |           | |  *****  |  |   |||| |      | |         | |            |  | |  |          | |   |  |  |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                ****** | |           | |  |  |   |  |   |||| |      | |         | |            |  | |  |          | |   |  |  |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |           | |  ****   |  |   |||| |      | |         | |            **** ****          | |   *******  **** ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***           | |         |  |   |||| |      | |         | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***               ***         |  |   ******      ***         ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ****                                                                                         

Assembly 1  model: 32     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | | |  |      | |  |  |   |  |    | |        |||||    |  | |          |  | ||^***          | |        | ^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^***** |  |      | |  |  |   |  |    | |        ||||^*****  | |          |  | ||||||          | |        |  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | | |  |      | |  |  |   |  |    | |        ||||        | |          ^*** ||||||          | |        |  ||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | | |  |      | |  |  |   |  |    | |        ||||        | |             | ||||||          | |        |  ||  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |          | | | | ****      | |  ****   |  |    | |        ||||        | |             ********          | |        ********         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |          | | | |    |      | |         |  |    | |        ||||        | |                               ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..      ***          *** | |    |      ***         |  |    ***        ****        ***                                                           
search RasMol script viewer Motif-ligand binding stats  niche ..                       ***    |                  ****                                                                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         ******                                                                                                               

Assembly 1  model: 33     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTIONAL REGULATOR ATRX
JMol viewer RasMol script viewer  ZN 3A  ..                                                                             *  *                             *  *                            
JMol viewer RasMol script viewer  ZN 2A  ..                                                                 *  *        |  |    *  *                     |  |                            
JMol viewer RasMol script viewer  ZN 1A  ..                *  *                      *  *                   |  |        |  |    |  |                     |  |                            
sec str:  .................ee....ee.........ee......eehhhhhhhhhhh.....................eee......eeehhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
seq num:  ..155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |   |    | ||| | |                |  || ||  |    | | |      | | |    |  | |      |  ||  |   ^***|  |      | |   |||||| ^*** |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |   ^***** |^*****                |  || ||  |    | | |      | | ^*****  | |      |  ||  |   | |||  |      | |   |||||| |||  |         
search RasMol script viewer Motif-ligand binding stats  PS00009 ..      | |          | | | |                |  || ||  |    | | |      | |         | |      |  |^***   | |||  |      | |   |||||| |||  |         
search RasMol script viewer Motif-ligand binding stats  PS00016 ..      ***          | | | |                |  || ||  |    | | |      | |         | |      |  ||      | |||  |      | |   |||||| |||  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | | | |                ***** ||  |    | | |      | |         | |      *****      | |||  |      | |   *****| |||  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | | | |                *******|  |    | | |      | |         | |      ****       ********      | |   *************         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | | ***                       |  |    *** |      | |         | |                   ***         ***                         
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***                           |  |      ***