triangle PDBeMotif: 2lbp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification periplasmic binding protein    | release date: Mon, Apr 10, 1989
Title structure of the l-leucine-binding protein refined at 2.4 angstroms resolution and comparison with the leu(slash) ile(slash)val-binding protein structure
Authors F.A.QUIOCHO, I.H.TSIGANNIK, J.S.SACK, S.D.TRAKHANOV
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
DDIKVAVVGAMSGPIAQWGIMEFNGAEQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSS
STQPASDIYEDEGILMISPGATAPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQD
GLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDA
AEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNW
DEKGDLKGFDFGVFQWHADGSSTKAK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : LEUCINE-BINDING PROTEIN
member of: CATH:search3.40.50.2300GENE3D:searchG3DSA_3.40.50.2300PANTHER:searchPTHR30483/searchPTHR30483_SF6PFAM:searchPF13458PRINTS:searchLEUILEVALBPSUPERFAMILY:searchSSF53822UniProt:searchP04816
sec str:  ....eeeeeee........hhhhhhhhhhhhhhhhhhhh.....eeeeeeeee..hhhhhhhhhhhhhhhh.eeeee.........hhhhhhhhh.eeee..............eeeee......hhhhhhhhhhhh....eeeeeee.hhhhhhhhhhhhhhhhh...eeeeeeee......hhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhh....eeeeee................eeeee..........hhhhhhhhhh.......hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh.........eee..eeee....eeeeee...eeeee.
sequence :  ..DDIKVAVVGAMSGPIAQWGIMEFNGAEQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATAPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKAK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                        |    |   | |||   |        | |          |       |     |   |         | |      ||| | ||| |  | | ||   ||  |       | |        | |    |   || ||    |       | |  | | |       || |    |                | | |    | || ^***     | ||||   |  || ||  | |    || ||||  | ||  | |   |  | || | |||              |  |      | ||  |       | |||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                        |    |   | |||   |        | |          |       |     |   |         | |      ||| | ^** |  | | ||   ||  |       ^**        | |    |   || ||    |       | |  | | |       || |    |                | | |    | || | |      | ||||   |  || ||  | |    || ||||  | ||  | |   |  | || | |||              |  |      | ||  |       | |||^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                        |    |   | |||   |        | |          |       |     |   |         | |      |^***  || |  | | ||   ||  |                  | |    |   ^***|    |       | ^*** | |       || |    |                | | |    | || | |      | ||||   |  || ||  | |    || ||||  | ||  | |   |  ^*** ^***|              |  |      | ||  |       | |||     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                        |    |   | |||   |        | |          ********^     |   |         | |      | | |  || |  | | ||   ||  |                  | |    |    |  |    |       | |  | | |       ********^                | | |    | || | |      | ||||   |  || ||  | |    || ||||  | ||  | |   |    |  | | |              |  |      | ||  |       | |||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                        ^*****   | |^*****        | |                        |   |         | |      | | |  || |  | | |^*****  |                  | |    ^*****  ^*****       ^***** | |        | |                     | | |    | ^*****      | ||^*****  || ||  | ^*****| ||||  | ||  | |   |    |  | | |              |  |      | ||  |       | |||     
search RasMol script viewer Motif-ligand binding stats  asxturn ..                                 | |||            | |                        |   |         | |      | | |  || |  | | |    |   |                  | |                           |  | ***        | |                     | | |    |  | |        | || |      || ||  |       | ||||  | ||  | |   |    |  | | |              |  |      | ||  |       | ***     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                 ****|            | |                        |   |         | |      | | ****| |  | | |    |   |                  | |                           ****            | |                     | | |    **** |        | ****      ********       ****||  ****  | |   |    **** | |              ****      | ||  |       ****|     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                   | |            | |                        |   |         | |      | |     | |  | | |    |   |                  | |                           |  |            | |                     | | |       ***        | || |       |  |            | ||  | |   | |   |       | | |                        | ||  |         | |     
search RasMol script viewer Motif-ligand binding stats  nest ..                                   ***            ***                        |   |         ***      | |     ***  | | |    |   |                  ***                           |  |            ***                     *** |                  | || |       |  |            ***|  | |   | |   |       *** |                        ***|  |         ***     
search RasMol script viewer Motif-ligand binding stats  niche ..                                   ***                                       |   |                  ***       **** ***    |   |                                                ****                                      ***                  ******       ****               **** |   | |   |         ***                           ****                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                             *****                                        *****                                                                                                                                                    ***** *****                                                            

   New search    2lbp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML